KEGG   Planococcus antarcticus: BBH88_00190Help
Entry
BBH88_00190       CDS       T04428                                 

Definition
(GenBank) ATP-binding protein
  KO
K17752  serine/threonine-protein kinase RsbT [EC:2.7.11.1]
Organism
pana  Planococcus antarcticus
Brite
KEGG Orthology (KO) [BR:pana00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pana01001]
    BBH88_00190
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pana03021]
    BBH88_00190
Enzymes [BR:pana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBH88_00190
Protein kinases [BR:pana01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBH88_00190
Transcription machinery [BR:pana03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BBH88_00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ANU08865
UniProt: A0A1C7DBP0
LinkDB All DBs
Position
553640..554041
Genome map
AA seq 133 aa AA seqDB search
MSDQSSVEILTEWDIVAARQLGRNVAKELGFGTVDQARITTAISELARNIYLYAGKGRIE
IQQLTENGIKGILIIAADSGPGIPDIRKVMEDGFTTSGGLGAGLPGVKRLMDDFKIETIL
GEGTDIRATKWLR
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagtcctcggtggaaattttgacagaatgggatattgttgctgcaagacaa
ctcggacgcaatgtggcgaaagagcttggctttggtacagttgaccaggcccgtattacg
acggccatcagcgagcttgctcgcaatatttatttatatgccggcaaaggcagaattgaa
attcagcaattaactgaaaatggcatcaaagggattttaattattgctgcagacagtggt
cctggaataccagatattcgcaaagtgatggaagatggctttacgacttctggtggatta
ggagcgggacttccaggagtcaagcggttgatggatgattttaaaatcgaaacaatttta
ggcgaaggtacagatataagagctaccaagtggcttcgttag

DBGET integrated database retrieval system