KEGG   Planococcus antarcticus: BBH88_02440Help
Entry
BBH88_02440       CDS       T04428                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pana  Planococcus antarcticus
Brite
Translation factors [BR:pana03012]
 Eukaryotic Type
  Elongation factors
   BBH88_02440
 Prokaryotic Type
   BBH88_02440
Mitochondrial biogenesis [BR:pana03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BBH88_02440
Exosome [BR:pana04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BBH88_02440
  Exosomal proteins of breast cancer cells
   BBH88_02440
  Exosomal proteins of colorectal cancer cells
   BBH88_02440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ANU09266
UniProt: A0A1C7DCQ8
LinkDB All DBs
Position
133737..134924
Genome map
AA seq 395 aa AA seqDB search
MGKAKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLAKKSGGEARSYAQIDNAPEEKERG
ITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIKGSALKALE
GEAEWEDKIVELMNAVDEYIPTPARDTEKPFMMPIEDVFSITGRGTVATGRVERGQIKIG
DNVDIIGLTEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVSRDDVQRGQVLAKPGTI
TPHTEFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVCNLPEGVEMVMPGDNIEM
IVSLISPIALEEGTKFSIREGGRTVGAGVVATITK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagctaaatttgatcgttctaaaacgcacgcgaatattggtacaattggtcac
gttgaccatggtaaaacaactttgactgcagcaatcgctacagttctagctaaaaaatca
ggcggggaagctcgttcatacgctcaaatcgacaacgctcctgaagaaaaagagcgcggt
atcacgatcaatacttcacacgttgagtatgaaactgaaactcgccactatgcacacgtg
gattgccctggacacgccgattatgttaaaaacatgatcactggtgctgctcaaatggac
ggcgggatcctggtagtatctgctgctgatggcccaatgccacaaactcgtgagcacatt
cttctttcacgtcaagttggtgttccttacctagttgtattcatgaacaaatgcgacatg
gtagatgatgaagaacttcttgaattagttgaaatggaagtccgcgatcttctttctgaa
tatgacttccctggcgatgacattcctgtcatcaaaggttctgctcttaaagctcttgaa
ggagaagcagaatgggaagataaaatcgtcgaattgatgaacgcagttgatgagtatatc
cctactccagctcgtgacactgaaaaaccattcatgatgcctattgaggatgtattctca
atcactggccgtggtacggttgctactggacgtgttgaacgcggacaaatcaaaattggt
gacaacgttgatatcatcggtcttactgaagaaccaaaatctacaactgtaacaggtgta
gaaatgttccgtaaattgcttgactacgctgaagctggcgacaacatcggtgcacttctt
cgcggggtttctcgtgacgacgtacaacgtggacaagtattggctaagccaggtacgatt
actccacacactgagttcaaagctgaagtttatgttctttcaaaagaagagggtggacgt
cacactccattcttcacaaactaccgtccacagttctacttccgtacaactgatgtaact
ggtgtttgtaaccttcctgaaggtgtagaaatggttatgcctggagataacatcgaaatg
atcgtttctctaatctctcctatcgcacttgaagaaggaactaagttctctatccgtgag
ggtggacgtactgtaggcgctggcgttgttgctacaatcactaaataa

DBGET integrated database retrieval system