KEGG   Planococcus antarcticus: BBH88_08165Help
Entry
BBH88_08165       CDS       T04428                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
pana  Planococcus antarcticus
Pathway
pana00260  Glycine, serine and threonine metabolism
pana00261  Monobactam biosynthesis
pana00270  Cysteine and methionine metabolism
pana00300  Lysine biosynthesis
pana01100  Metabolic pathways
pana01110  Biosynthesis of secondary metabolites
pana01120  Microbial metabolism in diverse environments
pana01130  Biosynthesis of antibiotics
pana01210  2-Oxocarboxylic acid metabolism
pana01230  Biosynthesis of amino acids
Module
pana_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
pana_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pana00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBH88_08165
   00270 Cysteine and methionine metabolism
    BBH88_08165
   00300 Lysine biosynthesis
    BBH88_08165
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BBH88_08165
Enzymes [BR:pana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     BBH88_08165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7 DUF5376
Motif
Other DBs
NCBI-ProteinID: ANU10277
UniProt: A0A1C7DFT4
LinkDB All DBs
Position
2667554..2668918
Genome map
AA seq 454 aa AA seqDB search
MKVSKFGGTSVASAQQIKKVAAIVKAEPSRKIVVVSAPGKRFDGDVKVTDLLINLSATAL
RDEPTEAPLAKVLGRYSEIADELGLANDIQKVIETDLMNRLQSDKSSPPLFADLIKASGE
DNAAKLIAAYLTSIGLAAEYVNPFDAGLFVNGLPERAQALPEAYDRLAALGNKETITVFP
GFFGYTKEGLLRTFERGGSDITGSILAAAVKAELYENFTDVDCVFAANPRVVENPVEIEQ
MTYREMRELSYAGFAVLHDEALMPVFKAAVPLCIRNTNNPAAPGTMIVAERNHSLRPVTG
ISADSGFSTLYVSKYLMNREIGFGRRLLQILEDEEISYEHIPSGIDNLSVILRSHQLTAD
KEQRIVDRVKTELLADDVHIRSDFSMIVLVGEGMNNTKGLTARAANAFARTGVNIEMINQ
GSSEVSLVFGILKEDEQKILNELYKEFFEPVLVH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagcaaatttggcggtacttcagtagctagtgcacaacagataaaaaaagta
gcggcaatcgttaaagcggagccttcccgcaagattgtcgtcgtctccgctcccggcaag
cgatttgatggagatgtaaaagtgacggatctgctgattaacttgtcagccaccgcactc
cgggatgaaccgaccgaagctcctcttgccaaagtcttgggacgctattcggaaattgca
gatgaattagggctagccaatgacatccaaaaagtcatcgaaactgaccttatgaaccgt
cttcaatccgataaaagttctccccctctttttgcggacctgatcaaagcaagcggcgaa
gacaacgctgcaaaattgatcgccgcttacctgacatccatcggtctcgccgccgaatac
gttaatccgtttgatgccggtttgtttgtaaatggcttgcctgaacgggcacaggcgctc
cctgaggcttatgatcgtctggcagcattgggcaataaagaaaccatcacagtcttccct
ggctttttcggttatacaaaagaaggcttgctgcggacattcgaacgcggcggatcagat
atcacaggctcaattctggcagctgcagtcaaggcggagctctatgaaaactttaccgat
gttgactgtgtgtttgcggcaaatccgcgtgtcgtcgaaaatcctgtcgaaatcgaacag
atgacttatcgggaaatgcgggaactttcatatgctggatttgcggttctgcacgatgaa
gccttgatgcctgtttttaaagcggcggttcctttatgcatccgcaataccaataatcca
gcagctccaggaactatgattgtcgcagagcgcaatcattcgctgcgccctgttactgga
atctccgcagacagcggcttctcaacgctctacgtcagtaaatacttgatgaaccgtgaa
attggttttggccgcagattacttcaaatattggaagacgaagaaatttcatatgaacat
atcccatctggtatcgataacctttccgttattttgcgcagccatcaattgactgccgat
aaagagcagcgaattgttgatcgtgtgaaaacagagcttctggctgatgatgtccatatc
cgaagtgatttttcaatgattgtcctcgttggagaaggcatgaacaataccaagggtctg
actgcccgcgcagcgaatgcgtttgccagaaccggagtcaatattgaaatgattaatcag
ggttcttccgaagtgagtttggtgttcggtatcttgaaagaagatgagcaaaaaatattg
aacgaattgtacaaagaattctttgagcctgttttggttcattaa

DBGET integrated database retrieval system