KEGG   Planococcus antarcticus: BBH88_08790Help
Entry
BBH88_08790       CDS       T04428                                 

Definition
(GenBank) hypothetical protein
Organism
pana  Planococcus antarcticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4129 MMgT
Motif
Other DBs
NCBI-ProteinID: ANU10392
UniProt: A0A1C7DG64
LinkDB All DBs
Position
complement(2532590..2533816)
Genome map
AA seq 408 aa AA seqDB search
MKSRLISAIYFMLDAFIISLVLVFVSKEAAALPVVWNWLLIALLASCISFMLFSRYSYRL
VWVIGISIVAVFGMWITGISLWLALILGMLTIYLLHGRYSVLNEEFNHGHHFLMKFTVVF
SICWIILLLNPEEQTGRLLFTIVPVVVLFYVASHLLYGYLHSREDGAKLSQAAGAFGIVF
SISALAAISTFFVAEEVRKLVGWAAGGAIRIVFWPLALLLEQASKFLSGLSTEGEMQETI
DKLGPEEKAAQNDTTASETMPTDFPVEMLLGIVVLVCVIALVLWLRKVKPDSEAPMQESL
SSIKRHDHQSSEQHMPTTYASCGTNMNLHQIREVFRDLEQMAKEQDLGRKNYETVREWIT
RVQWDVTDSFYRTYDRVRYGDKQLPGSQATDFINEIEKIKGKYLKENV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcacgtttaatatcagccatctactttatgctggatgctttcattatttctctg
gtattggtgtttgtttctaaggaagcggcggcattgccggtagtttggaactggttgtta
atagctttgctggcatcatgcatttcctttatgcttttttctaggtactcttaccgactg
gtatgggtaatcggcatttctattgttgcggtatttggcatgtggataacgggtatttca
ttgtggctggcgctgattttaggtatgctaactatttacctgctccatgggcgctattcg
gttctcaatgaagaattcaatcatggccatcattttttgatgaagtttacggttgttttt
agtatctgctggattatacttctgctaaatcctgaagagcagacaggtcgcttgcttttc
actattgttcctgttgtagtgctgttctatgtggcttctcatctgctgtatggttacctt
cattccagggaagacggtgcgaaactcagtcaagcggctggtgcatttggtattgttttc
agtatttctgccttagcggcaatcagcactttctttgttgcagaagaagtccggaaattg
gtaggttgggctgcaggcggggcaattcggattgtgttttggccactcgctttgttactt
gagcaggccagtaaatttttgtctggcttatcgacagaaggagaaatgcaggaaacgata
gacaagcttgggccggaagagaaagcagcgcagaacgatactacagcaagcgagacaatg
ccgacagattttccagttgaaatgcttttggggattgtcgtgctggtatgcgtaattgca
cttgtgttatggctgaggaaagtaaaacccgattcagaagcgccgatgcaagaaagttta
agcagcatcaaaaggcatgaccatcaatcttcagaacagcatatgccgactacttacgca
tcttgtggcactaacatgaacttgcaccaaatcagagaagtttttcgtgatcttgagcaa
atggcaaaagagcaggacttgggacggaaaaattacgagacggtccgcgagtggataaca
cgagtgcaatgggatgtcacagactccttttacaggacctatgaccgagtccgatatggg
gataagcaattgcccgggtcccaggccacggactttattaatgaaatcgaaaaaataaaa
ggcaaatatttaaaagaaaatgtttaa

DBGET integrated database retrieval system