KEGG   Planococcus antarcticus: BBH88_08950Help
Entry
BBH88_08950       CDS       T04428                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pana  Planococcus antarcticus
Pathway
pana00010  Glycolysis / Gluconeogenesis
pana00020  Citrate cycle (TCA cycle)
pana00620  Pyruvate metabolism
pana01100  Metabolic pathways
pana01110  Biosynthesis of secondary metabolites
pana01120  Microbial metabolism in diverse environments
pana01130  Biosynthesis of antibiotics
pana01200  Carbon metabolism
Module
pana_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBH88_08950
   00020 Citrate cycle (TCA cycle)
    BBH88_08950
   00620 Pyruvate metabolism
    BBH88_08950
Enzymes [BR:pana01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BBH88_08950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_2
Motif
Other DBs
NCBI-ProteinID: ANU10423
UniProt: A0A1C7DGT8
LinkDB All DBs
Position
complement(2496898..2498280)
Genome map
AA seq 460 aa AA seqDB search
MAYKFRLPDIGEGIHEGEIVKWFVKAGDKIEEDDVLVEVQNDKAVVEIPSPVSGTIEEVL
VEEGTVAVVGDILIRIDAPDADEDEDEGAKEEATPEVKEETEEQVQAGTAESGGDVDKAP
VKEEPKKQTGAGSQTQTDSTTESDPTARVISMPSVRKFARDSDIDIKQVTGSGNNGRVLR
EDIEAFMNGDQKAATPTDSEEAPQEVAEESTDQAAAAPKATAAPEGEFPETREKMSGIRK
AIAKAMVHSKQTAPHVTLMDEVDVTELVAHRKKFKDIAAEKEIKLTYLPYVVKALVSTLR
EFPALNTSFDDETSEIIQKHYFNIGIAADTEKGLMVPVIKNADRKSVFTISDEINGLATK
ARDGKLSAAEMKGASCSITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPVIKNGEIVAA
PVLALSLSFDHRMIDGATAQHALNHIKRLLSQPELLLMEA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaatttcgtttgccggatattggagaaggtatccatgaaggtgaaattgta
aagtggtttgtcaaagcaggagataaaatcgaagaagacgatgtgcttgttgaagtgcaa
aatgataaagctgtcgttgaaattccatcaccagtatctggaacaattgaagaagtactg
gttgaggaaggaacagtagccgtagttggcgatatattgatccggatcgatgcacctgat
gccgatgaagacgaggacgagggtgctaaagaagaagcaactcctgaagtgaaagaagaa
accgaagagcaagtacaagcgggtactgctgaatctggtggagatgttgataaagcacct
gttaaagaagaaccgaaaaaacagactggtgctggctcacaaacacagactgattcaaca
acagagtctgacccaactgctcgtgtgatttcaatgccatctgtccgcaaatttgcgcgc
gacagtgatatagacattaaacaagtaacgggttctggtaataatggtcgcgtattaaga
gaagatattgaagcgttcatgaacggtgaccaaaaagcagcaacaccaacagattctgaa
gaagcaccacaggaagtagcagaagaaagcactgatcaagcagcagctgcaccaaaagca
acagcagctcctgaaggtgaattccctgaaacgcgtgagaaaatgtccggaatacgtaaa
gcaattgctaaagcaatggttcattctaaacaaactgctccgcacgtaacattaatggac
gaagtggatgttactgaactcgtagcacaccgcaaaaagttcaaagatattgcagcagaa
aaagaaatcaagctgacttatctaccatacgtagtaaaagctttggtcagcacattgcgt
gaattcccagctttgaatacatcatttgatgatgaaacaagcgaaattatccaaaagcat
tatttcaatatcggaattgcagcagatacagaaaaaggcttaatggttccagttatcaaa
aacgcagaccgtaaatcagtatttacgatttcagatgaaatcaatgggttagcaacaaaa
gcgcgcgatggtaaattatccgctgctgaaatgaaaggcgcttcatgctcgattacaaat
atcggttctgccggcgggcaatggttcacaccggtcattaaccatccagaagtggcgatt
cttggaattggccgcatcgcagagaaacctgtaattaaaaatggtgaaattgtagcagca
cctgtgttagcattatcattgagcttcgatcacagaatgatcgatggtgcaacggcacaa
catgcattaaatcatattaaacgtttattaagtcaacctgaattactattaatggaggcg
taa

DBGET integrated database retrieval system