KEGG   Planococcus antarcticus: BBH88_08985Help
Entry
BBH88_08985       CDS       T04428                                 

Definition
(GenBank) hypothetical protein
Organism
pana  Planococcus antarcticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CompInhib_SCIN
Motif
Other DBs
NCBI-ProteinID: ANU10430
UniProt: A0A1C7DFV5
LinkDB All DBs
Position
complement(2490334..2490528)
Genome map
AA seq 64 aa AA seqDB search
MKQMIQIIRKADVEKEYVHVLKLELDYELASLFDAIQQKDEHQMSKSKQRLQEIHVELEA
LHAL
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatgattcagataatccgcaaagcggatgtagagaaagaatacgtacacgtg
ctgaaactggaactcgattatgaacttgcttcattatttgacgcgatacagcagaaagac
gaacatcaaatgtctaaaagcaagcagcggcttcaagaaattcacgtagaactggaggcc
ctccatgcgctctaa

DBGET integrated database retrieval system