KEGG   Planococcus antarcticus: BBH88_09370Help
Entry
BBH88_09370       CDS       T04428                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
pana  Planococcus antarcticus
Pathway
pana02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pana00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BBH88_09370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pana02000]
    BBH88_09370
   02035 Bacterial motility proteins [BR:pana02035]
    BBH88_09370
Transporters [BR:pana02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BBH88_09370
Bacterial motility proteins [BR:pana02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BBH88_09370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd DUF3693
Motif
Other DBs
NCBI-ProteinID: ANU10500
UniProt: A0A1C7DG23
LinkDB All DBs
Position
2418776..2419624
Genome map
AA seq 282 aa AA seqDB search
MSTYFSKKKTVLTTGAVVALLLTGCSNEENTAEEEKTAWAEIQEKGSMTVATSGTLLATS
FRDAESDELTGFEVEVVRELGERLDLDIDFTELGFDEMLTSVNTGQIDLAANDIEITEDR
AEQFVFSTPIKYSYGTAVVRKDDLSGIATLEDLAGKKAAGASTSIYMEIARDYGAEEVTY
DNATNEVYLRDVSIGRTDVILNDYYLSTFGVAAFPELNITIHPDIKYAPSEVGLVMNKDN
TELADNVNKALEEMLEDGTITEISEEFFGGADVSVKPDIEEN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtacatatttttcgaagaaaaagacggttttaaccacaggagcggtcgttgcgtta
ttgttaacagggtgtagtaatgaggaaaatacagcggaagaagaaaaaacagcgtgggct
gaaattcaagaaaaaggatccatgactgtagccacttctggtactttactggccacttct
tttcgcgatgcagagtctgatgagttaactggttttgaagttgaagttgtacgagaactt
ggcgaacgactcgatttagacatcgattttactgagcttggatttgatgaaatgctgaca
agtgtcaataccggtcaaattgaccttgccgcgaacgacattgaaattaccgaggaccgt
gctgaacagtttgttttttcgactccgattaaatattcttatggtactgcagttgttcgg
aaagatgatttgtccggtattgcgactctggaagacttagcaggaaaaaaagcagcgggt
gcttctacatcaatttatatggaaattgctcgtgactacggtgcagaagaagtgacgtat
gacaatgcaacgaacgaagtgtatttacgtgacgtttcaattggacgcacagatgtcatt
ctcaatgactattatttatcaacatttggcgttgctgcttttcctgagttgaatatcacc
attcacccagatattaaatatgcaccatcagaagttgggcttgttatgaacaaagacaat
acagagcttgccgataacgtcaataaagctttggaagaaatgctggaagacggcaccatt
acggaaatttccgaagagtttttcggtggtgcagatgtctctgtcaaacctgatattgaa
gagaattaa

DBGET integrated database retrieval system