KEGG   Planococcus antarcticus: BBH88_09380Help
Entry
BBH88_09380       CDS       T04428                                 

Definition
(GenBank) hypothetical protein
Organism
pana  Planococcus antarcticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FbpA NFACT-R_1 NFACT-R_2 LMBR1
Motif
Other DBs
NCBI-ProteinID: ANU10502
UniProt: A0A1C7DGG9
LinkDB All DBs
Position
2416325..2417989
Genome map
AA seq 554 aa AA seqDB search
MAFDGLFTKSMTGELQQLVTGRISKVHQPNQLELLLHIRAQGKNHKLLISIHPSYSRIHL
TAAANVNPSEPPMFCMLLRKHIEGGVITEISQYGMDRLIMLKIKAKNEIGDDIERELHVE
MMGRHSNVILIDAERTMILDSLKHLPPSVNSFRTILPGQPYIFPPSQEKKDPFEAIDELS
KVEPTEIVGQFSGFSPLNARELAFRLETSDDKSETTKAFLADFLKDNPTGYYVEHQGKSF
FSASPLTHIEENGLEFPTLGELLDRMYYAKAERDRVKQQAGDLERWLQNEISKLKLKLKK
LKKEQDQAEKRDVLQLNGELIMANLHRMTKGMKEIEVDNYYNDEKVTITLDPRKTPIDNS
QRYYSRYQKAKTAVVKTQEQISKTEEDIEYFETLMSQVQQAGISDIEEIREELAEQGYMK
VQKSKKKKKPTKPSVEPYVSSTGTPISVGKNNKQNDYVTFKVASKSDTWLHTKDIPGSHV
IIHDTDPDETTILEAATIAAYFSKARESSSVPVDYTEVRQVKKPNGSKPGFVIYFEQKTV
FVTPDEELVIKLKK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatggattattcacaaaatcgatgactggcgaacttcaacaactggtcacc
ggcaggatttcaaaagttcatcagcccaaccagcttgaactgcttttacatatacgtgct
caaggaaaaaatcataaactattaatttcgattcacccttcgtattcacggattcatttg
acggctgcggcgaacgtcaatccttccgagccaccaatgttttgtatgttactgcgtaag
catatcgaaggtggcgtcatcactgagatttcccagtatgggatggaccgcctcatcatg
ctgaaaatcaaagcgaaaaatgaaattggtgatgatattgaacgtgagttgcacgtcgaa
atgatgggacgacattcgaacgttattttaatcgatgccgagagaactatgattcttgac
agcctgaagcatttgccgccgagcgtcaattcgtttcggactattcttcctggacaaccc
tatattttcccaccatcacaagagaaaaaagatccatttgaagcgatcgacgaattgagc
aaagtcgagccgactgaaattgtcggccaattttctggcttttctccactcaatgcccgt
gagcttgcgtttcgtctggaaacttccgatgacaagtcagaaaccactaaagcatttctt
gctgatttcttgaaggacaatccgaccggctattatgtcgagcaccagggcaaaagcttc
ttttctgccagtcccttgactcatatcgaggaaaacggacttgaattcccaacactcggt
gagctactcgaccgaatgtattacgccaaagctgaacgcgaccgtgtgaaacaacaagct
ggtgatttggaaagatggctgcagaatgaaatttccaagctgaaactcaaactgaaaaag
ttaaaaaaagaacaagaccaagctgaaaagcgcgatgttcttcagttaaatggtgaatta
attatggccaaccttcaccgcatgactaaaggcatgaaggaaattgaagtcgataattat
tacaatgacgaaaaagtgaccatcacattagatccgcggaaaacgccgattgataattcg
caacgctattactcgcgctatcagaaagcaaaaacagccgttgtcaaaacgcaagaacaa
atcagcaaaactgaagaagatatcgagtatttcgaaactttaatgtctcaagtccaacaa
gctggtatttccgatatcgaggaaattcgtgaagaactagctgaacaaggctatatgaaa
gtacagaaatcaaagaaaaagaaaaaaccgacaaagccttctgtggaaccctatgtatcc
tctaccggtacaccgatttcagtcggtaaaaacaacaagcaaaacgattatgtaacgttc
aaagtagcatcaaaatccgatacatggctgcacactaaggatatccctggatctcatgtc
atcattcatgacaccgatccggatgagacgactatacttgaagcagccaccattgccgca
tactttagcaaagcgcgagagtcgtcttctgttcccgtcgactacaccgaggtgcgacaa
gtgaaaaaaccaaatggttcaaagccaggtttcgtcatttatttcgaacagaaaacggta
tttgtgacgcctgacgaagaactggtaatcaaattaaagaaatag

DBGET integrated database retrieval system