KEGG   Planococcus antarcticus: BBH88_09430Help
Entry
BBH88_09430       CDS       T04428                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pana  Planococcus antarcticus
Brite
KEGG Orthology (KO) [BR:pana00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pana01001]
    BBH88_09430
Enzymes [BR:pana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBH88_09430
Protein kinases [BR:pana01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBH88_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo Seadorna_VP7 Pkinase_fungal Haspin_kinase RAMP4 FTA2 YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: ANU10511
UniProt: A0A1C7DGX2
LinkDB All DBs
Position
complement(2405859..2407847)
Genome map
AA seq 662 aa AA seqDB search
MLIGKSINGRYKIKELIGGGGMSNVYLAHDMILDRDIAIKILRYDFSNEEELRRRFQREA
LSTTSLAHPNIVNIFDVGEDGSVHYLVMEYVPGKTLKEYIMEHSPVSPERAVEIMKQLTS
ALAHAHHNQIVHRDIKPQNILMDAEGNVKISDFGIAMALSATSYTQTNSVLGTVHYLSPE
QARGGMANKKSDIYSLGIVMYELITGKLPFSGESAVSIALKHLQTETPSLRDSVPDLPQS
LENVVLKATAKNIQHRYQSADEMEADLVTVLLPERLNELKFMVPVDQDETRAMPVIKDSA
AYTSATDTKTMPLPLSGSKKEPKASGEKKKKWPWILGVLAFLLIGGLVLAIAFPGLFEPR
QIAVPDVSEMERNEALEELQAAGFTAGEETEEYSEQIEANHIIRTIPEAGKMRDRETEVQ
LFTSLGKETVEMDDFVGSTIEKASEALVDENFASVKSTEEFSNEPVGTILNQEPAAGENV
IVSETDVEFIVSKGKDLRDVEDLAGFTEENLNDYARSSGFNIRIVSEQSSDEVEAGKVMS
QTPAAGEQLEAGSTIEVILSAGVAEQPMKTYIHTVDIPYEPAEPAEPAEPAAEGEEPVEQ
TVQIYIQDNSHTMVEPFEEFTITEDQPHRIELQIAEGESASYRIVRDSTIILEETFDYSK
VE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgctgattggcaagagcataaacggccgttacaagatcaaggaattgatcggcggcggt
ggaatgtctaatgtgtatttggcacatgacatgattttggaccgggatatcgctattaag
attttgcgctatgatttctccaatgaagaagaactgcgcaggcgattccaaagagaagcc
ttgtctacaaccagtttggcgcatccgaacattgtcaatattttcgatgtcggcgaagat
ggctctgtgcattatctggtgatggaatatgttccaggaaaaaccttgaaggaatacata
atggaacattcaccagtatctcctgagcgggctgttgaaattatgaaacaactgacatcg
gctttggcgcacgctcatcacaaccagattgtccacagagacatcaaaccgcaaaatatt
ttgatggatgcggaaggcaatgtgaaaatatccgatttcggtattgcgatggcattaagt
gcgacttcctatacccaaacgaattcggtgttgggaactgtccactatttatcgcctgaa
caagcgcgtggcggtatggccaataaaaaatccgatatctattcactcggaatcgtcatg
tacgaattgatcacaggaaagttaccgttttcaggtgaatcggccgtgtctatcgcatta
aagcacctgcagacagaaacaccctctttacgtgattccgttcccgacctgccgcaaagc
ttggagaacgtcgtcttgaaggcgactgcaaaaaacatccagcaccgctatcagtctgct
gatgaaatggaagcggatctggttacagtgttgttaccagaacggttgaatgaactgaaa
ttcatggtacctgtcgaccaggatgaaacacgtgccatgcccgtcattaaagactcagct
gcttatactagcgctacagataccaaaacgatgccgttgccactgagcgggtcaaaaaaa
gagccaaaagcttctggagaaaagaaaaagaaatggccgtggatactgggagtgctggct
tttctattgattggcggactggttctggcaattgcttttccaggattgtttgagccgaga
caaatcgctgtgccggatgtttctgagatggaacgcaacgaagcgcttgaagagcttcaa
gcggctggctttactgctggcgaagaaaccgaagaatattcagagcagattgaagcaaat
cacatcattcggacaattcccgaagctggaaaaatgagagaccgtgaaacagaggttcaa
ttgtttaccagtttgggcaaagaaacggttgagatggacgattttgttggtagcacgatc
gaaaaggcatcagaagcattagtagatgaaaatttcgcttctgtgaaatcaactgaagaa
ttttcgaatgaaccggtgggcaccattctaaaccaagaaccggctgccggagaaaatgtc
atcgttagtgaaaccgatgtcgagtttattgttagcaaagggaaagatctgcgcgacgtc
gaggatctggcaggatttacggaagagaaccttaacgattatgctcgttcttccggcttt
aatatccgcatcgtttcagaacagtcatcagatgaagtcgaggcaggcaaagttatgtcc
cagactcctgcagcaggagaacagctggaagccggcagcacgattgaagtgatcttgtcg
gcgggtgtggcggaacagccgatgaaaacgtatatccataccgtcgatatcccttatgaa
ccggctgaaccggctgaaccggctgaaccggctgcagaaggcgaagaaccggtagagcag
accgtccagatttatattcaggacaattcacatacaatggtggagccgttcgaggagttt
acgattactgaagatcagcctcatcgcattgaactgcagattgctgaaggggagagtgct
tcttaccgaattgttcgcgactctacaattattttagaagagacttttgactattcaaaa
gtagaataa

DBGET integrated database retrieval system