KEGG   Planococcus antarcticus: BBH88_17700Help
Entry
BBH88_17700       CDS       T04428                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pana  Planococcus antarcticus
Pathway
pana00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pana00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBH88_17700
Enzymes [BR:pana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BBH88_17700
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BBH88_17700
    1.1.1.-  
     BBH88_17700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N Pyr_redox_3 ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANU11956
UniProt: A0A1C7DKC0
LinkDB All DBs
Position
739948..740997
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGEKDIRIEERELKALKDNEVTVRVAWAGICGSDLHEYQEGPVFVPTEKEDQLT
GQVAPLIMGHEFAGIIEKVGSQVTKFKVGDRVAINPTLTFGNKPEDIDQYDGFSFIGLHG
DGGFTTFANAPESNVYLLPETLSLQEGALVEPTAVAVQAIKEGGLQFGDTTAIFGAGPIG
LVTVIAAKAAGASKIIVLDLSETRLEKAKELGATHVVNSGKENPVEAIRAIVPEGVDVSF
EVAGVAPTFTQAIASTKARGTMVIVSIFARPIEWNPLQLTNTGVKITSSIAYTPTSFQQT
VDLMGTGQLNPQSIVTSQIQLDDIVEKGFEALTKDKTQVKILVELSGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggtatggtatggagaaaaagatattcgcatcgaagaacgggagttaaaa
gcattaaaagacaatgaagtaacggtccgtgttgcttgggcgggtatttgcggcagcgat
ttgcatgagtatcaagaagggccggtttttgtccctactgaaaaagaggaccaattaacg
ggtcaagtagcaccgcttatcatgggacacgaatttgcaggcattattgaaaaagtaggg
tcacaagtaactaaattcaaagtgggagatcgcgttgcaatcaatcctacgttaactttt
ggtaacaaaccagaagacattgatcaatacgatggtttcagctttattggtcttcacgga
gatgggggattcactacttttgccaatgcacccgaatcgaatgtttaccttcttccagaa
acattaagtctgcaagaaggtgcgctggttgaaccaacagccgttgctgtacaagcgatt
aaagaaggcggacttcaatttggtgatactacagcaatatttggtgctggacctattggt
ttagtgaccgtaattgcggcaaaagctgcaggagcaagcaaaatcattgttttggattta
tcagaaacgcgtctggaaaaagcaaaagaattgggtgcaacgcatgttgttaactccgga
aaagaaaatcccgtagaagcaattcgtgcaattgttccagaaggggtagatgtatcattt
gaagtggcaggtgtcgcgccaacattcacacaggcaattgcgtcaacaaaagcacgtgga
acgatggtgattgtgtctattttcgcgagacccatcgaatggaatccccttcaattgacc
aataccggtgtgaaaattacatcttctattgcctatacacccacttcattccaacaaacg
gtagacttgatggggacgggccaattaaacccacaaagtattgtcacctctcaaattcaa
ttagatgatattgtggaaaaagggtttgaggctttaacgaaagataaaacacaagtgaaa
atccttgtagaattaagcggtgaaaagtaa

DBGET integrated database retrieval system