KEGG   Paenisporosarcina antarctica: E2636_04425Help
Entry
E2636_04425       CDS       T05927                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
panc  Paenisporosarcina antarctica
Brite
KEGG Orthology (KO) [BR:panc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:panc02000]
    E2636_04425
Transporters [BR:panc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    E2636_04425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 AAA_29 SbcCD_C AAA_22 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: QBP40419
LinkDB All DBs
Position
881676..882575
Genome map
AA seq 299 aa AA seqDB search
MTLKIEHVTKKFGDFMAVNDLSMTVKQGSMYGFLGANGAGKTTIFRMILGLLDATEGAIT
WNGQPITYASSKHIGYLPEERGLYPKMKVADQLVYLGQLRGMKKNEAKFAASKWLERFEV
PHYAHKKVEELSKGNQQKIQVIASIIHKPSLIILDEPFSGLDPINVEMLKKAILDIQKEG
ATIVFSSHRMDHVEELCEQLCILHHGESIVSGTLSEVKRGFGLQNVRLKADFDLTYLGQM
DGVSSFKPSKEGGIFQISEERTAHELLRAALEKGNIRYFAIEEPSLHDIFIQKVGENHA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacattgaaaattgagcatgttacaaagaaatttggggattttatggcagttaatgat
ctatccatgacagttaaacaggggagtatgtatggttttttaggtgctaacggtgctggg
aagacaactatatttcgcatgatcttaggattattggatgctactgaaggagctattacg
tggaatggacaaccaattacctacgcaagtagtaaacacattggttatttacctgaagaa
cgaggcttgtatccaaaaatgaaagttgcagaccagttagtatatttaggacagcttcgt
ggtatgaagaagaacgaagctaaattcgcagcgagtaaatggcttgaacgttttgaagtt
cctcactatgcacacaaaaaagtagaggaattatcaaaagggaatcagcaaaaaattcaa
gtgattgcttctataattcacaaaccttcgcttattattttagatgaaccgtttagtggt
ttagatccaataaacgttgaaatgttaaaaaaagcgatattagacattcaaaaagagggg
gcaacaatcgttttctctagtcaccgcatggaccatgtagaagaattgtgcgagcaactt
tgcattttacatcacggggaatcgattgtaagcggaactctcagcgaagtgaagcgagga
tttgggcttcaaaacgtgcgattgaaagctgattttgacttaacatatttaggacaaatg
gatggtgtgagttcgtttaaaccttcaaaagaaggtggtatattccaaatttcagaagaa
cgtacagcacatgaattattacgtgcggcattagagaaagggaacattcgttattttgca
atagaagaaccatctttacatgatatcttcatccaaaaggtaggtgaaaatcatgcgtga

DBGET integrated database retrieval system