KEGG   Pandoraea sp. XY-2: DRB87_04825Help
Entry
DRB87_04825       CDS       T06086                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pand  Pandoraea sp. XY-2
Brite
KEGG Orthology (KO) [BR:pand00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DRB87_04825
Enzymes [BR:pand01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DRB87_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin Thi4 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QBC30817
UniProt: A0A411J8W3
LinkDB All DBs
Position
1045971..1047569
Genome map
AA seq 532 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKSAEMKALVDEIAPLSPQIAVVVHADGGD
SAGERRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPVKLDDDTVAQIRALD
GDFRFETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQGEVEARRVMAVPTVFL
NGESFTQGRTSVKELLAKLDTGASVRAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGI
VTGVVAERFGGQVLDTMAIENFVSVTHTEGPKFATALEQHVKTHDVDVIDTQRAQALIPG
KIHEVHLASGAVLKARSVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAV
VGGGNSGVEAAIDLAGIVKEVTLIEYGTQLRADDVLQRKLRSLPNVRVLMNAQTTEIRGD
AQKVDGLVYRDRASGEVSTIALEGVFVQIGLVPNTEWLKGSVSLTRHGEIEVDAKGATSV
PGVFAAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLSSVEDEAVTPEKIAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtaccttcagaaagtcacgcgcccg
atcgagatcgccgtgtggctcgacgacagcccgaagtcagccgagatgaaggcgctggtc
gacgagatcgccccgctctcgccgcagatcgccgtcgtggtgcacgccgacggcggcgac
agcgcgggcgagcgtcgtccgtccttcgccatcggcacgccgggggaagcaccgcgcatc
cgcttcgccgggctgcccatggggcacgagttcacgtcgctggtgctcgccttgctgcaa
gtgggcggtcacccggtcaagctcgacgacgacaccgtcgcgcagattcgtgcgctcgac
ggcgatttccgcttcgagacctacatctcgctgtcgtgccagaactgtccggaagtcgtg
caggcgttgaacgtcatggcgctgatcaatccgcgcatccagcaagtcaccatcgacggc
gcgttgttccagggcgaagtcgaggcgcgtcgggtgatggcggtccccaccgtgttcctc
aacggcgaatcgttcacgcagggccgcaccagtgtgaaggaattgctcgcgaaactcgac
accggtgcaagcgtgcgcgccgcgaaggcgctcgagaacaagccggtctacgacatgctg
atcgtgggcggcggccccgcaggcgctgccgccgcgatctacgccgcccgcaagggaatt
gtgacgggcgtggtcgccgagcgcttcggcggccaggtgctcgacacgatggccatcgag
aatttcgtctcggtgacgcacaccgaaggaccgaagttcgccacagcactcgaacagcac
gtgaagacgcatgacgtcgacgtgatcgacacgcagcgcgcgcaagccttgattcccggc
aagattcacgaagtgcatctggccagcggcgcggtgctcaaggcgcggtcagtggtgctg
gccaccggtgcgcgctggcgtgaaattggcgttccgggcgaacgtgagtaccgtaaccgg
ggcgtagcctattgcccacactgcgacggcccactcttcaagggcaagcgtgtggcggtc
gtcgggggtggcaactcgggcgtggaagccgccatcgatctggccggcatcgtcaaggaa
gtcacgctgatcgaatacggcacgcaactgcgcgcggacgacgtccttcagcgcaagctg
cgcagcctgccgaatgtgcgtgtgctgatgaacgcacagacgaccgagatccgtggcgac
gcgcagaaggtggacggtcttgtgtatcgcgaccgtgcctcgggagaggtttccacgatc
gcgctcgaaggcgtgttcgtgcagatcggtctcgtgccgaacaccgaatggctcaagggg
agcgtgtcgctcacgcgtcacggcgaaatcgaagtcgatgccaagggcgcgacgtcggtg
cccggcgtgttcgccgcgggcgacgtcacgaccgtgccgttcaagcagatcgtgatcgcc
gtcggggaaggcgcgaaggcctcgctgggcgccttcgagcatctgatgctcagctcggtg
gaggacgaggcggtaacgcccgagaaaatcgccgcctga

DBGET integrated database retrieval system