KEGG   Pandoraea sp. XY-2: DRB87_18045Help
Entry
DRB87_18045       CDS       T06086                                 

Gene name
queG
Definition
(GenBank) tRNA epoxyqueuosine(34) reductase QueG
  KO
K18979  epoxyqueuosine reductase [EC:1.17.99.6]
Organism
pand  Pandoraea sp. XY-2
Brite
KEGG Orthology (KO) [BR:pand00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pand03016]
    DRB87_18045 (queG)
Enzymes [BR:pand01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     DRB87_18045 (queG)
Transfer RNA biogenesis [BR:pand03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    DRB87_18045 (queG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1730 Fer4_16 Fer4_7 Fer4_9 Fer4 Fer4_21 Fer4_10 Fer4_2 Fer4_3 Fer4_17 Fer4_18
Motif
Other DBs
NCBI-ProteinID: QBC34006
UniProt: A0A411JHW6
LinkDB All DBs
Position
complement(3992151..3993398)
Genome map
AA seq 415 aa AA seqDB search
MFPATAAQVESAAPPNASEVSSSRDNATSPALDAGDLAVLAGQIRAWASELGFGRVGITD
IDLSHAEAGLQQWLDDGCHGDMDYMAAHGMKRARPAELVPGTVRVISARMNYLPNDTDMA
SWRERETARAAMPAEAVVSIYARGRDYHKVMRHRLQQLAERITQAIGPFGYRAFTDSAPV
LEVELAQKAGLGWRGKHTLLLSRDAGSLFFLGEIFVDVPLPVDADALSTPSEVQGKATGH
RLQPGEHCGQCQRCRDVCPTGAITEAFRVDARLCVSYLTIEHKGAIPENLRAKMGNRIYG
CDDCQLYCPWNKFAQPSPLADFAPRNRLDSASLVELFAWSETEFMDKLAGSPIRRIGHER
WLRNLAVGLGNALRDSADAAARAPLRDALLARRDHPSALVREHVEWALAQEGAAA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
attttccccgctaccgccgcacaagtcgagtcggcggcacctccgaatgcctcggaagtg
tcgtcctcgcgcgacaatgcgacgtctcccgccctcgatgccggggacttggccgtgctt
gccggtcagattcgcgcatgggcgagcgaactcggttttggccgggtcggcatcacggac
atcgatctctcgcacgccgaagcggggctgcaacagtggctcgacgacggctgtcatggc
gatatggactacatggcggcgcacggcatgaagcgcgcgcggcccgcggagctggttccc
ggcacggtgcgcgtcatcagcgcacgcatgaactatcttccgaacgacaccgacatggcg
agctggcgcgagcgtgaaaccgcgcgcgcggcgatgcctgccgaggcggtcgtgtcgatc
tatgcgcgcggacgcgactatcacaaggtcatgcgccatcggctgcaacaactggccgaa
cgcattacccaggccatcgggccgttcggctaccgcgcattcaccgattcggccccggtg
ctcgaagtcgaactcgcgcagaaggccgggctgggctggcgcggcaagcacaccctgctg
ctctcgcgcgacgcggggtcgctcttctttctcggcgaaatctttgtcgacgtgccgctg
ccggtggatgccgatgcgctcagcacgccgagcgaggtgcaaggcaaggcaacggggcac
cgcctgcaaccgggcgagcactgcgggcaatgtcagcgatgccgcgacgtttgtccgacc
ggcgccatcaccgaagcgtttcgcgtcgatgcgcggttgtgcgtgtcgtatctgacgatt
gagcacaagggcgcgattcccgagaatttgcgcgcgaagatgggcaatcgcatctatggc
tgcgacgattgccagctctactgcccgtggaacaagtttgcacagccgtcgccgctcgcc
gatttcgctccgcgcaaccggctcgatagcgcctcgctcgtggaactgttcgcctggagc
gaaacggaattcatggataagctggccggcagccctattcgtcgtattggtcatgagcga
tggttgcgcaatctggccgtggggctcggcaatgcgctgcgcgactcggcagatgccgcc
gcgcgcgcgccgctgcgcgatgcgttgctcgcgcgacgcgatcacccatcggcgttggtg
cgcgagcatgtcgaatgggcgctggcccaggaaggagccgcagcttga

DBGET integrated database retrieval system