KEGG   Pantoea sp. PSNIH2: PSNIH2_00125Help
Entry
PSNIH2_00125      CDS       T03514                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSNIH2_00125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:panp02000]
    PSNIH2_00125
Enzymes [BR:panp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PSNIH2_00125
Transporters [BR:panp02000]
 Other Transporters
  Pores ion channels [TC:1]
   PSNIH2_00125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AIX72333
LinkDB All DBs
Position
29394..30059
Genome map
AA seq 221 aa AA seqDB search
MIVVHHLNNSRSQRILWLLEELELPYEIKRYQRQTSMLAPPELKKVHPLGKAPVITDGDR
VVAESGAILEYLVGRYDRNRLLTPLDEEEALECRYWLHYAEGSLMPLVVMRLIFSRMGKP
PVPWLLRPIGAAFGNGVRKGFLDKQLTTHRQFIEQHLTRLPWFAGQHLTLADIQMTFPIQ
GLAARGGLDGMPATQAWLDKISRRPAWQRAIQQGGELNLPD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggttcatcatctgaataactcccgttcgcagcgtattctctggctgctggaa
gagctggagctgccgtatgaaatcaagcgctatcagcgtcagacgtcgatgctcgccccg
ccggaattgaaaaaagtgcatccgctgggcaaagcaccggtaatcaccgatggcgaccgc
gtcgtagcggaatcaggcgcgattctggaatatctggtcgggcgttacgatcgcaaccgg
ctgctgacgccgctggatgaggaagaagcgcttgaatgccgctactggttacactatgcg
gaaggatcgctgatgccgctggtggtgatgcgcctgatcttcagccgcatgggcaagccg
ccggtgccgtggctgctacgcccgatcggcgcggcgttcggcaacggcgtccgtaaaggc
tttctcgataaacagctgaccacgcaccgtcaatttatcgaacagcatctgacccggctg
ccgtggttcgctggacagcatctgacgctggccgatattcagatgaccttccccattcag
gggctggcggcgcgcggcgggctggatggcatgcccgctacacaggcctggctggataaa
atcagccgccgtcccgcctggcagcgggcgattcagcagggtggcgaactgaatttgccg
gactaa

DBGET integrated database retrieval system