KEGG   Pantoea sp. PSNIH2: PSNIH2_04075Help
Entry
PSNIH2_04075      CDS       T03514                                 

Definition
(GenBank) membrane protein
Organism
panp  Pantoea sp. PSNIH2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AIX73029
LinkDB All DBs
Position
880700..881872
Genome map
AA seq 390 aa AA seqDB search
MSETTIHTSTGKALIACTSFAVFLTYLTAGLALPVIPLFVHQELGYSNLMVGVAVGVQFF
ATLLTRSFAGRRADRHGAKITTQQGMLAIALVGAAYLLAAQLPLAAAGKFALLVVGRLLL
GFGESLLLTGNMTWGLGLVGPKRSGLVMSWNGMAIYGALAAGAPLGLWIHARWGFSGLGV
VALLLPLFSLALNVWIRSVPVQGGERPSLWRVIGQIFSPGCALALQGVGFAAIGTFTSLW
FAERNWGNAGFALSAFGCAFVLVRIFFGTLPDRLGGRRVAVASLAIEVAGLLLMGFSTSG
TMALAGAALTGCGCSLVFPALGVEVVKRVAPQVRGTALGGFAAFQDIAYGVTGPLTGLLA
TSFGYGAVYFAAAVCAALGMMLSLSIRRQP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacgacaatccacacttcaacaggcaaggcgttaatcgcctgcacctctttc
gccgtcttcttaacctatctgaccgccgggctggcgctgccggtgatcccgctgtttgtg
catcaggagctgggctacagcaacctgatggtgggcgtggcggtaggcgtgcaatttttc
gccacgctgctgacgcgcagcttcgccggcaggcgcgctgaccggcacggcgcgaaaatc
accacccaacagggcatgctggcgatcgcgctggtcggcgcggcctatctgctcgccgcc
cagctgccgctggccgccgccggaaaattcgcgttgctggtggtggggcgtttgctgctg
ggctttggcgaaagtctgctgctgaccggcaatatgacctgggggctggggctggtgggg
ccgaaacgttccgggctggtcatgtcctggaacggcatggccatttacggcgcgctggcg
gcaggagcgccgctggggctgtggatccatgcgcgctggggctttagcgggttaggcgta
gtagcgctgctgttgccgctgttctcgctggcgcttaacgtctggattcgttcggtgccg
gtgcagggcggggaacgcccttcgctgtggcgcgtgattgggcagattttctcgccgggc
tgcgcgctggcgctacagggcgtgggctttgccgccatcggcaccttcacttcgctctgg
tttgcggaacgcaactggggcaatgccggtttcgccctgagcgcttttggctgcgctttt
gtgctggtgcgtatcttcttcggcacgttgccggaccgtctgggcggccgccgcgtggcg
gtggcgtcgctggcgattgaggtggcgggactgctgctgatggggttctctaccagcgga
acaatggcgctggcgggcgccgcgctgaccggctgcggctgttcgctggtcttcccggcg
cttggcgttgaggtggtgaaacgggtcgcgccgcaggtgcgcggcacggcgctgggcggt
ttcgccgcctttcaggatatcgcttatggcgtcaccgggccgttgaccggcctgctggcg
acatcgttcggctacggcgcagtctatttcgccgccgccgtctgcgccgcgctcggcatg
atgctttcgctctcgattaggcgtcagccttag

DBGET integrated database retrieval system