KEGG   Pantoea sp. PSNIH2: PSNIH2_04895Help
Entry
PSNIH2_04895      CDS       T03514                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00030  Pentose phosphate pathway
panp01100  Metabolic pathways
panp01110  Biosynthesis of secondary metabolites
panp01120  Microbial metabolism in diverse environments
panp01130  Biosynthesis of antibiotics
panp01200  Carbon metabolism
panp01230  Biosynthesis of amino acids
Module
panp_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
panp_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSNIH2_04895
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PSNIH2_04895
Enzymes [BR:panp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PSNIH2_04895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II DUF3343
Motif
Other DBs
NCBI-ProteinID: AIX73175
LinkDB All DBs
Position
1072907..1073848
Genome map
AA seq 313 aa AA seqDB search
MNNAEHLANVMVTAFIDAVERGVDLVPVVADSTSTAKIAPFVKKFPERLVNVGIAEQTLV
GAAAGLALAGKIAVTCNAAPFLIARANEQVKVDICYNNTNVKLFGLNAGASYGPLASTHH
AIDDISVLRGFGNIEIFAPATPRECRQIIDYALEHIGPVYIRMDGKALPEFHDEAWRFTP
GAVNVLRDGNDIALVAMGSTVHEAVEAADRLARQGIAATVISLPSIRPLDRQALSQSLGG
IKYVISVEEHNINGGVGSIVAEVLAEYGHGAQLKRLGIKDGEYAIAADRRDMRAWHGIDA
DGVERQALSLIGD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatgcagaacatctggcgaatgtgatggtgacggcgtttatcgacgccgtcgag
cgtggcgtggatctggtgcctgtggttgctgactccacctctacggccaaaatcgcgccg
tttgtgaaaaagtttcctgagcggctggtcaatgtcggtatcgccgagcagacgctggtg
ggcgccgccgctggcctggcgctggccggaaaaatcgccgttacctgcaacgccgcgccg
tttcttatcgcgcgcgctaatgagcaggtcaaggtcgatatttgctacaacaacaccaac
gttaaactgtttggtctgaacgcaggtgcaagctacggcccgctggcgagcacgcaccac
gctattgatgatatttccgtgctgcgcggcttcggcaatattgaaatattcgcgcccgcc
acgccgcgggaatgccgacagattatcgactacgcgcttgagcatatcggcccggtttat
attcgcatggatggaaaagcgctgccggaattccacgatgaagcatggcgcttcacgccg
ggcgcggtaaacgtgctgcgcgacggcaatgatattgcgctggtggcgatgggctctacg
gtgcatgaagcggtagaagccgccgatcggcttgcccgtcagggcattgccgccacggtg
attagcctgccttctattcgaccattggatcggcaggcgctgagccagagcctgggcggc
attaaatacgtgatttccgtagaggaacataacattaacggcggcgttggcagtattgtc
gcggaggtgttggctgaatatggacacggcgcgcagcttaagcgtctcggtattaaagat
ggtgaatatgctattgccgccgatcgcagagatatgcgcgcctggcacggcatcgatgcg
gatggcgtagagcgtcaggcgctgagccttataggggattga

DBGET integrated database retrieval system