KEGG   Pantoea sp. PSNIH2: PSNIH2_04965Help
Entry
PSNIH2_04965      CDS       T03514                                 

Definition
(GenBank) oxidoreductase
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00040  Pentose and glucuronate interconversions
panp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSNIH2_04965
Enzymes [BR:panp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     PSNIH2_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N ADH_N_2 FAD_binding_3 Shikimate_DH NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AIX73186
LinkDB All DBs
Position
complement(1088737..1089747)
Genome map
AA seq 336 aa AA seqDB search
MKSVVIEQPGELRIQTRPLPEPASGEVRVKVRYASICGSDVHIWHGHNPFARYPRVIGHE
FFGVIDAVGAGVDAGRIGERVAVDPVVSCGHCYPCSVGRPNVCRELQVIGVHRDGGFSEY
AVAPASNAYRVPDSIPDKLASLIEPFTIAANITAFLQPAAQDVALIYGAGPMGLTAIQVL
KGVYGVRQVLVVDRLPERLALAQQSGADAVFNNSEVPLAAQLEGVQPTLIIDAACHPAIL
AEAAALASPAARIGLLGFSAEPCTVTQQSLTSKELSLFTSRLNSHRFSQVIDWIERGAIQ
PEKLVTHYFPLAQVEQAMTLFEKDPRTCCKVILSIE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgttgtcattgaacaaccgggcgagctgcgtatacaaacgcgtccgctgccg
gaacccgcctcaggcgaagtgcgggtaaaagtacgctacgccagcatctgtggctccgac
gtgcatatctggcacggccataatccgttcgcacgctacccgcgcgtgatcggccatgaa
tttttcggcgtgatcgacgccgtcggcgcgggcgttgacgccggacgtatcggcgaacgc
gtggcggtcgatccggtggtgagctgcggccactgctatccctgctccgtcgggcgtccc
aacgtctgccgcgaactacaggtgatcggcgttcatcgcgacggcggcttcagcgaatat
gccgtggcgccggccagcaatgcgtatcgcgtcccggacagcatccccgataagctcgcc
agcctgattgagccgttcaccatcgcggccaatatcactgcgtttttgcagcctgccgcg
caggatgtggcgctgatctacggcgccgggccgatggggctgacggcgattcaggtattg
aaaggggtatacggcgtacgccaggtgctggtggtcgatcgtctgccggaacgtttggcg
ctggcgcaacaaagcggcgccgacgcggtctttaataacagcgaggtgccgctggccgcg
cagctggaaggcgtacagccgacgctgattatcgacgccgcctgccatcctgcgattctg
gcagaagcggcggcgcttgcttctccggcggcgcgcatcgggctgttgggcttctccgcc
gagccctgcaccgtgacgcagcagagcctgaccagcaaagagctgtcgctgttcacctcg
cgcctgaacagccaccgattctcgcaggttatcgactggatcgagcgcggcgctattcag
ccggaaaaactggtcacgcactacttcccgctggctcaggtcgagcaagcgatgacgcta
ttcgagaaagacccacgtacctgttgcaaagtcattttgtccattgaataa

DBGET integrated database retrieval system