KEGG   Pantoea sp. PSNIH2: PSNIH2_10055Help
Entry
PSNIH2_10055      CDS       T03514                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00020  Citrate cycle (TCA cycle)
panp00480  Glutathione metabolism
panp01100  Metabolic pathways
panp01110  Biosynthesis of secondary metabolites
panp01120  Microbial metabolism in diverse environments
panp01130  Biosynthesis of antibiotics
panp01200  Carbon metabolism
panp01210  2-Oxocarboxylic acid metabolism
panp01230  Biosynthesis of amino acids
Module
panp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
panp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSNIH2_10055
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSNIH2_10055
Enzymes [BR:panp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PSNIH2_10055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIX74083
UniProt: A0A0A1B0F9
LinkDB All DBs
Position
complement(2177952..2179205)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGQKITLDGQGKLVVPANPIIPYIEGDGIGVDVSPVMIKVVDAAVKKAYNG
ERKISWMEIYTGEKSTQVYGPDVWLPEETLDLIKDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYICLRPVRYYQGTPSPVKRPQDTDMVIFRENSEDIYAGIEWKAGTPEADKVIKFL
REEMGVNKIRFPEQCGIGVKPCSEAGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELLDGGPWVKIKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSVILS
AEMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIISNM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtcagaaaatcacgcttgacggtcagggc
aaactggttgtccctgctaatccgatcatcccttatatcgaaggtgacggcattggcgtg
gatgtatctcctgtcatgatcaaagtggttgatgccgctgtgaaaaaagcctacaacggc
gagcgaaaaatttcctggatggaaatttacaccggtgagaaatccacgcaggtgtatggc
ccggacgtatggctgccggaggagacgcttgacctgattaaggactatcgcgttgccatc
aaaggcccgttgacgacgccggttggcggcggtatccgttctcttaacgttgcgctgcgt
cagcagctggacctgtacatctgtctgcgtccggtacgctactatcagggcaccccaagc
ccggtaaaacgtccgcaggacaccgatatggtgatcttccgtgaaaacagtgaagacatc
tatgccggcatcgagtggaaagcgggcactccggaagcggataaagtgatcaagttcctg
cgcgaagagatgggcgtgaacaagattcgcttcccggaacagtgcggcatcggcgtgaag
ccttgctctgaagcgggcactaagcgcctggtgcgcgcggcgattgaatatgccatcacc
aacgatcgcgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggc
gcgtttaaagactggggctaccagctggcgcgcgaagagttcggcggcgagctgctggac
ggcggcccgtgggtgaaaatcaagaacccgaacaccggcaaagagatcgttattaaagac
gtgatcgccgatgcgttcctgcagcagattctgctgcgcccggccgagtacgacgtgatc
gcctgtatgaacctgaacggcgactacatctctgacgctctggcggcgcaggttggcggc
atcggcatcgcgccgggcgctaacatcggcgacgagtgcgcgctgtttgaagcgacgcac
ggcaccgcgccgaaatacgcaggccaggacaaagtcaacccaggctctgttatcctttcg
gcggaaatgatgctgcgccatatgcagtggttcgaagccgcagacctgattgttaaaggc
atggaaggcgctatcgccgcgaaaaccgtgacctatgacttcgaacgtctgatggaaggc
gctaagctgctgaaatgttcagagtttggcgacgcgattatcagcaacatgtaa

DBGET integrated database retrieval system