KEGG   Pantoea sp. PSNIH2: PSNIH2_10855Help
Entry
PSNIH2_10855      CDS       T03514                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00061  Fatty acid biosynthesis
panp01100  Metabolic pathways
panp01212  Fatty acid metabolism
Module
panp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSNIH2_10855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:panp01004]
    PSNIH2_10855
Enzymes [BR:panp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PSNIH2_10855
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PSNIH2_10855
Lipid biosynthesis proteins [BR:panp01004]
 Fatty acid synthase
  Component type
   PSNIH2_10855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AIX74224
LinkDB All DBs
Position
2337334..2337852
Genome map
AA seq 172 aa AA seqDB search
MVEKRESYTKEDLIASGRGELFGAEGPPLPSGNMLMMDRVVKMSKEGGNFNKGYVEAELD
INPDLWFFACHFIGDPVMPGCLGLDAMWQLVGFYLGWLGAEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRVINRKLVMGVADGEVLVDGHVIYTASDLKVGLFKDTTAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaacgcgaatcctatacaaaagaagatctcattgcctctggtcgcggtgaa
ctgtttggcgctgaaggcccgccgctgccgtctggcaatatgctgatgatggaccgcgtg
gtcaaaatgagcaaagaaggcggtaactttaataaaggttatgtcgaagctgaactggat
atcaatcctgacctctggttcttcgcctgtcactttattggcgatccggtcatgccgggc
tgtctgggtctggatgcgatgtggcagctggtaggcttctatctgggttggctgggcgct
gaaggcaaaggccgcgcgctgggcgtaggcgaagtgaaatttaccggtcaggtactgccg
acggcgaaaaaagtgacctaccgcattcatttcaaacgcgtcattaaccgcaaactggtg
atgggcgtagcggacggcgaagtgctggtggatggccatgtgatctataccgccagcgat
ttgaaagtgggcctgtttaaagacaccaccgcgttctaa

DBGET integrated database retrieval system