KEGG   Pantoea sp. PSNIH2: PSNIH2_15865Help
Entry
PSNIH2_15865      CDS       T03514                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00790  Folate biosynthesis
panp01100  Metabolic pathways
Module
panp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:panp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSNIH2_15865 (folP)
Enzymes [BR:panp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PSNIH2_15865 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AIX75099
LinkDB All DBs
Position
complement(3429724..3430557)
Genome map
AA seq 277 aa AA seqDB search
MKLYARDSHLDLSHPHVMGILNVTPDSFSDGGQHNTLVAALTHANEMINAGATIIDIGGE
STRPGAEEVSTEQELERVIPVVEAIAQRFEVWISVDTSKPEVIRESARVGAHIINDIRSL
QLPGALEAAAETGLPVCLMHMQGEPASMQTAPHYDNLLQEIDEFFARQIARCEAAGIKKS
QLLLDPGFGFGKNLSHNYQLLAHLADFHHFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
ACAVIAAMQGAQIIRVHDVKETVEAMRVVEATRSAKE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacgctcgggattcccacctggatttgtcacatccccatgtcatgggcatt
cttaacgtcacacctgactctttttccgacggcggccagcacaatacgctggttgcggcg
ctgacccatgctaatgagatgattaacgccggtgcgaccattatcgatatcggcggtgaa
tctacccggcccggcgcagaggaagtcagtactgagcaggaactggagcgcgttattccc
gtcgtggaggcaatcgcgcaacgcttcgaagtgtggatttccgtcgatacgtcaaaacct
gaagtcataagggaatcagcgcgagtaggcgctcacatcattaacgatatccgctcgctt
cagcttcccggcgcattggaggcggcggcggaaactggcttgccggtttgtctgatgcat
atgcagggcgaaccggccagcatgcagacggcaccgcactatgacaatttgctgcaggag
atcgatgagtttttcgcccggcaaatcgcccgctgtgaagctgccgggattaaaaaatcg
cagctgctactcgacccaggcttcggattcggtaagaatctcagccacaactatcaatta
ctggcgcatctggccgactttcaccattttggtctgccgctgctggttggtatgtcgcgc
aaatcgatgattggacaactgctgaatgtagggccttctcaacgtctgaccggcagcctg
gcttgtgcagtgattgcagctatgcagggtgcgcagattatccgcgtacacgacgttaaa
gagaccgtagaggcgatgcgcgtcgtcgaagcgacacgttcagcgaaggaataa

DBGET integrated database retrieval system