KEGG   Pantoea sp. PSNIH2: PSNIH2_18765Help
Entry
PSNIH2_18765      CDS       T03514                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
panp  Pantoea sp. PSNIH2
Pathway
panp00564  Glycerophospholipid metabolism
panp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:panp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PSNIH2_18765 (glpD)
Enzymes [BR:panp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PSNIH2_18765 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 3HCDH_N Pyr_redox_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AIX75597
UniProt: A0A0A1B9N5
LinkDB All DBs
Position
complement(4074835..4076343)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRAGLFLYDHLGKRTSLPGS
KGLRFGAESVLKPEISRGFEYSDCWVDDARLVVLNAQEVVKRGGEVRTRTRATRAWRENG
MWMVEAQDVDTGKTWTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYKGDPKQVKIDDKEIDYLLKVYNAHF
KKPLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVRDDAGNAPLLSVFGGKLTTYRK
LAEHAMEKLAKYYPNAGPAWTKNAVLPGGDIAGTREDYAAGLRRRYPFISEGLARHYART
YGSNSELILQNASSLADLGEDFGHSFHEAELRYLVENEWVRELDDAIWRRTKLGMWLNEA
QQARVAQWLETHSKKPALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgatcgttatcggcggcggcatcaacggtgccggcattgcggcc
gatgccgcaggacgcggactgtctgtgctgatgctggaggcgcaggatctggcgtgcgcc
acctcttccgccagctcgaagctgattcacggcggcctgcgctacctggagcattatgaa
ttccgcctggtgagcgaagcgctggccgagcgtgaagtactgctgaaaatggcgccgcat
atcgctttcccgatgcgcttccgcctgcctcatcgcccccatttgcgtccggcctggatg
atccgcgccggtctgtttctgtatgaccacctcggcaaacgcaccagcctgccgggcagt
aaaggattgcgttttggcgcagaatcggtgctgaagccggaaatctcgcgcggtttcgaa
tattccgactgctgggtggacgatgcgcgcctggtagtgctgaacgcgcaggaagtggtg
aaacgcggcggcgaagtgcgtacccgcacccgcgccacgcgcgcctggcgtgaaaacggc
atgtggatggtggaagcgcaggatgtcgacaccggcaaaacctggacctggcgcgccaaa
ggcctggtaaacgccgccggtccgtgggtgaaacagctgtttgacgacggcctgaagctg
aaatcgccgtatggcattcgtctgatcaaaggcagccatattgtggtgccgcgcgtgcat
accgaaaagcaggcctacatcctgcagaacgaagatcaccgcatcgtgtttgtgattccg
tggatggatgagttctccatcatcggcaccaccgacgtagaatataaaggcgatccgaag
caggtaaaaatcgatgataaagaaatcgactatctgctgaaggtttataatgcgcacttt
aaaaagccgctgggccgcgacgatatcgtctggacctactccggcgtacgtccgctgtgc
gatgatgagtcggattcgccgcaggcgattacccgcgactacacgctcgacgtgcgcgac
gatgcgggcaatgcgccgctgctgtcggtattcggtggcaaactgaccacctatcgcaag
ctggccgagcatgcgatggaaaaactggcgaagtattatcccaacgccggtccggcatgg
acgaaaaacgccgtgctgccgggcggcgatatcgccggcacgcgcgaagattacgccgcc
ggcctgcgccgtcgctatccgtttatcagcgaaggcctggcgcgtcactatgcccgcact
tacggcagcaacagcgagctgattctgcagaacgccagctcgctggcggacctgggcgaa
gatttcggtcacagcttccatgaggccgaactgcgttacctggtagagaatgagtgggtg
cgcgaactggacgacgccatctggcgccgcaccaagctcggcatgtggctgaacgaagcg
cagcaggcgcgcgtcgcgcagtggctggaaacgcacagcaaaaaacctgccctttctctc
gcttcctga

DBGET integrated database retrieval system