KEGG   Pantoea sp. PSNIH2: PSNIH2_23305
Entry
PSNIH2_23305      CDS       T03514                                 

Definition
(GenBank) conjugal transfer protein
Organism
panp  Pantoea sp. PSNIH2
SSDB
Other DBs
NCBI-ProteinID: AIX76672
LinkDB
Position
pPSP-cd6:51404..52870
AA seq 488 aa
MRGTMSPVQFKSAALALCIASAAASAQAADDNQSGTFGISLPSVNNSAIGYGKDVSGAVS
DKLYYTLGGGSVISQPATRSNMRKIGMSAGWSSDLMCGNFDLKTTVGNQLNGVTNGFKNL
MGDVVQNATGAVASLPAMIIQRANPGLYDMLTNGVLQANVSFDKAQLNCQNMSKRMMDFA
GNNKWTQGAVMDEYRSLVNSGDADAVRVNNSADKLQGNSGQNWIGGQKRGGQGQKAIRPT
HDLTAAGFNMMNSLPVLSSDTISSNSCNGGACGKYASAEEAAKAVVQVVGDSSLRTCSDA
SQCTSGDDEQQPGATQAGTGFAPILEETTKENTEQLVKLVNGTEQPNATNLAKLKTGSLP
ITAGVIRALQRDPDNAALTARLAGELAMADTVETALIMRRMIVTGMSEPNAAAQNAAIEE
GDRRVAAIDREITALRNEMELKRELSRNSVLTIIDRENGRVNSNPQTQSDDSTDNRMNHL
AVPETENN
NT seq 1467 nt   +upstreamnt  +downstreamnt
ctgagaggcacaatgtcaccagttcaatttaaatcggccgcacttgccctgtgtattgcg
tccgcagcggcatccgcgcaggcagctgatgataaccagtccggcacattcggtatttca
ctgccctccgtaaataacagcgccataggctacggcaaggacgtcagcggcgcggtttct
gacaagctctactatacgctcggcggcggctcagtgatttcacagccggcaacgcgcagc
aacatgcgtaaaatcggtatgagcgcaggctggagcagcgacctgatgtgcggcaacttc
gacctgaaaacgacggtcggtaatcagctcaacggggtaacaaatggcttcaaaaatctc
atgggcgacgtggttcagaacgccaccggtgccgtcgccagcttgccggcaatgattatc
cagcgtgccaatcccggcctgtacgacatgctcacaaacggcgtgctgcaggcaaacgtc
tcttttgataaagcccagctcaactgccagaacatgtcgaagcgcatgatggattttgcc
ggcaacaacaaatggacgcagggcgcggtaatggatgagtaccgatcgcttgttaacagt
ggagacgctgatgctgtccgcgtgaataactcagcggacaagctgcagggcaactcaggc
cagaactggatcggcggacaaaaacggggcggtcaggggcagaaggccatccggccaacg
catgacttaacggccgcagggttcaatatgatgaacagcctgccggtattgagctctgac
acgatcagcagcaacagctgtaacgggggagcctgcggaaaatatgcgagtgctgaagaa
gccgctaaagccgtggttcaggttgtgggagacagctccctgcgcacctgcagcgatgca
tctcagtgtacaagcggcgatgacgaacagcagccgggggctactcaggccggcactggc
tttgctccgattctggaagagaccaccaaagagaatactgaacagctggtaaaactcgtt
aatggcaccgaacagcccaacgcgactaacctggcaaagctcaaaacaggcagtttgccc
atcactgcaggcgttatcagagcacttcagcgggatcctgataacgcagccctgaccgcc
cgcctcgccggcgagctggcgatggcggatacggttgaaaccgcgctgattatgcgccgc
atgattgttaccggcatgtctgagcctaacgcagccgcgcagaatgcggccattgaggaa
ggcgatcgtcgcgttgcggccatcgatcgtgagatcaccgctttgcgaaatgaaatggag
ctcaagcgcgagctgtctcgtaattcagtgctcaccattatcgatcgtgaaaacgggcgc
gttaacagtaatcctcagacgcagagcgatgacagcaccgacaaccgtatgaaccatcta
gccgttcctgagacggaaaacaactga

DBGET integrated database retrieval system