KEGG   Pseudomonas antarctica: A7J50_0864Help
Entry
A7J50_0864        CDS       T04830                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
panr  Pseudomonas antarctica
Pathway
panr00970  Aminoacyl-tRNA biosynthesis
panr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:panr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A7J50_0864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:panr03029]
    A7J50_0864
Enzymes [BR:panr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A7J50_0864
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A7J50_0864
Mitochondrial biogenesis [BR:panr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A7J50_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ANF84305
UniProt: A0A172YVI4
LinkDB All DBs
Position
complement(1022862..1024307)
Genome map
AA seq 481 aa AA seqDB search
MQWEVVIGLEIHTQLATQSKIFSGSATTFGAEPNTQASLVDLGMPGVLPVLNQEAVRMAV
MFGLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGYLDIPLEDGTIKRVGVT
RAHLEEDAGKSLHEEFPGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKTIHALVRYL
GICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEVRRQIELIED
GGKVIQQTRLYDPNKDETRAMRSKEEANDYRYFPDPDLLPVVLEDSFLNDIRATLPELPQ
QKRERFQAQFGLSVYDASVLASSREQANYFEKVVSIAGDAKLAANWVMVELGSLLNKQGL
EIDEAPVTAEQLGGMLLRIKDNTISGKIAKTVFEAMAAGEGNADEIIDKRGLKQVTDSGA
ISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKSKLE
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaagttgtgatcgggctggagattcatacccagctcgccacccaatcgaag
attttctccggtagcgccaccacgttcggcgcagagcccaacacccaggccagcctggtc
gacctgggcatgcccggcgtactgccggtgttgaaccaggaagcggtgcgcatggcggtg
atgttcggcctggcgattgacgccgagatcggccagcacaacgtgttcgcgcgcaagaac
tacttctacccggacctgcccaagggctaccagatcagccagatggaattgccgatcgtc
ggcaaaggctacctggacatcccgctggaagacggcaccatcaagcgtgttggcgtcacc
cgcgcgcacctggaagaagatgccggcaagagcctgcatgaagaattcccgggcgctacc
ggcatcgacctgaaccgtgccggcacgccgttactggaaatcgtctccgagccggacatg
cgcagcgccaaggaagccgtggcttacgtcaagacgatccacgcgctggtgcgctacctg
ggcatctgcgacggcaacatggccgaaggctcgctgcgttgcgactgtaacgtgtcgatc
cgtccaaagggccaggtcgagttcggcacccgctgcgagatcaagaacgtcaactcgttc
cgttttatcgagaaggcgatcaacagcgaagtgcgtcgccagatcgaactgatcgaagac
ggcggcaaggtgatccagcaaacccgcctgtacgatccgaacaaagatgaaacccgcgcc
atgcgcagcaaagaggaagccaacgactaccgttacttccccgacccggacctgttgccg
gtggtccttgaggattcgttcctcaatgacatccgtgccaccctgccggaattgccgcag
caaaaacgcgagcgtttccaggcgcagttcggcctgtcggtctacgatgccagcgtattg
gcgtccagccgtgagcaagccaactacttcgaaaaagtcgtgagcattgccggcgacgcc
aaactggcggccaactgggtaatggttgagctgggcagcctgttgaacaagcagggcctg
gaaatcgacgaagcaccggttaccgccgaacaactgggcggcatgctgctgcgcatcaag
gacaacaccatctccggcaaaatcgccaagaccgtgtttgaagcgatggcggcaggcgaa
ggcaatgcggacgaaatcatcgacaagcgtggcctgaagcaagtcaccgacagcggtgcg
atctcggccgtactcgatgagatgctggcggccaacgccgaacaggtcgagcaataccgc
gccgcagacgaagccaagcgcggcaagatgttcggcttctttgtcggtcaggcgatgaaa
gcctccaaaggcaaggccaacccgcaacaggtgaacgaactgctgaaaagcaagctcgaa
ggctga

DBGET integrated database retrieval system