KEGG   Pseudomonas antarctica: A7J50_0949Help
Entry
A7J50_0949        CDS       T04830                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
panr  Pseudomonas antarctica
Pathway
panr00473  D-Alanine metabolism
panr00550  Peptidoglycan biosynthesis
panr01100  Metabolic pathways
panr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A7J50_0949
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7J50_0949
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A7J50_0949
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:panr01011]
    A7J50_0949
Enzymes [BR:panr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A7J50_0949
Peptidoglycan biosynthesis and degradation proteins [BR:panr01011]
 Precursor biosynthesis
  Amino acid ligase
   A7J50_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 ATPgrasp_YheCD TTL GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ANF84390
UniProt: A0A172YW69
LinkDB All DBs
Position
1107155..1108111
Genome map
AA seq 318 aa AA seqDB search
MTTNYDALFSTITPADFGRVAVLFGGKSAEREVSLKSGNAVLEALQSAGVNAFGIDVGDD
FLARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHSVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDAI
KEQELMDLTAKACEALGIAGWARADVMQDDQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASIEPRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaactacgacgccctgttttccaccatcacgcctgccgacttcggccgcgtg
gccgtgctgtttggcggcaagagcgctgagcgcgaagtgtcgctcaagtccggcaatgcc
gtgcttgaggcgctgcaaagcgccggcgtgaacgcgttcggtatcgacgtgggcgatgat
ttcctcgcccgcctgcaagccgagaagattgatcgcgcctttatcatcctgcacggccgt
ggcggtgaagacggcagcatgcaaggcctgctcgagtgcgccggcatcccttacaccggc
agcggcatccttgcttcggcactggcgatggacaagttgcgcaccaagcaggtgtggcac
agcctgggtattccaaccccgcgtcacagcgtgctgtgcagcgaagacgattgtatttct
gcagccaaggaactgggcctgcctttgatcgtcaaacctgcccatgaaggctccagtatc
ggcatggccaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgattcgcaagtgttggtggaacagtggatccagggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccgcctatcgcattgggcacgccccacaccttttatgactac
gacgccaaatacctggcctccgatactcagtaccggatcccatgtggcctcgacgcaatc
aaggaacaggaattgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tgggcgcgggcagacgtgatgcaggatgaccaagggaatttctggttccttgaagtcaac
actgctcccggcatgaccgatcacagcctggtacctatggcagcccgtgccgccggtttg
gatttccagcagttggtgctggcgatcctggccgcaagcattgagccaagaggctaa

DBGET integrated database retrieval system