KEGG   Pseudomonas antarctica: A7J50_1285Help
Entry
A7J50_1285        CDS       T04830                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
panr  Pseudomonas antarctica
Pathway
panr00620  Pyruvate metabolism
panr00680  Methane metabolism
panr01100  Metabolic pathways
panr01120  Microbial metabolism in diverse environments
panr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7J50_1285
  09102 Energy metabolism
   00680 Methane metabolism
    A7J50_1285
Enzymes [BR:panr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A7J50_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANF84720
UniProt: A0A172YX30
LinkDB All DBs
Position
1449976..1452621
Genome map
AA seq 881 aa AA seqDB search
MSDIDARLREDVHLLGELLGNTIREQYGDDFLDKIEQIRKGAKADRRGSVSEQTAGEELS
ASLNQLQESELLPVARAFNQFLNLANIAEQYQLIHRRDESQPAPFESRVLPELLARLQSE
GHSNESLARQLARLEIELVLTAHPTEVARRTLIQKYDAIAAQLALQDHRDLTTAEREQIR
ERLQRLIAEAWHTEEIRRVRPTPVDEAKWGFAVIEHSLWQAIPNYLRKADHALHAATGLH
LPLEAAPIRFASWMGGDRDGNPNVTAPVTREVLLLARWMAADLYLRDIDHLASELSMQQA
SPALQAKVGDSVEPYRALLKQLRERLRATRQWAHTALTANTPAPAEVLQNNRDLLDPLEL
CYQSLHECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHSAAMTEITDYLGLGRY
EDWDEEARISFLTKELSNRRPLLPGYFKPSADTAEVLNTCKEIAAAPAASLGSYVISMAG
AASDVLAVQLLLKESGVQRPMRVVPLFETLADLDNAGPVMECLLQLPGYRARLHGPQEVM
IGYSDSAKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILS
QPPGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPAWRHLMD
ELAADGVSAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIF
GWTQTRLMLPAWLGWEAALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIA
RLYDERLVQPDLLPLGAHLRDLLSQACSVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPL
HLLQAELLARSRQQEAAQDSPLEQALLVSVAGIAAGLRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatatcgatgcacgcttgcgtgaggatgttcacctgctgggtgaactgttgggc
aacaccattcgagagcaatacggcgatgatttcctcgacaagatcgagcagatccgtaaa
ggcgccaaggccgaccgccgtggcagcgtatccgagcaaaccgccggcgaggaactcagc
gccagcttgaaccaactgcaggaaagcgaactgttgcccgtggcgcgagcctttaaccag
ttcctcaacctggccaacatcgccgagcagtaccagttgatccaccggcgcgatgagtcg
caaccggcaccgttcgagtcccgtgtattgccggagctgctggcccgcctgcaaagcgaa
ggtcacagcaacgaatccctggcccgccagttggcgcggttggagattgaattggtcctc
accgcccacccgactgaagtggcgcgccgcaccctgatccagaaatacgatgcgatcgcc
gcgcaactggcgctgcaggatcaccgcgatctcaccacggccgagcgcgagcagatccgc
gaacggttgcagcggttgatcgccgaagcctggcacaccgaagaaatccgccgcgtgcgg
cccaccccggtggatgaagccaagtggggctttgcggtgattgagcattcgttgtggcag
gccatcccgaattatttgcgcaaggctgaccacgccttgcacgcggccaccggcctgcac
ttgccactggaggccgcgccgattcggtttgcctcgtggatgggcggggaccgtgatggc
aacccgaatgtcaccgcgccggtcacccgcgaagtgctgttgctggcgcgctggatggcg
gcggatttgtatttgcgtgatatcgatcacctggcgtccgagctgtcgatgcaacaggcc
agcccggcgttgcaagccaaggtcggcgatagcgtcgagccgtatcgcgccttgctcaag
caattgcgtgaacgtctgcgtgccacgcggcaatgggcgcacaccgcattgaccgccaac
accccggcacccgccgaggtactgcagaacaaccgcgacctgctcgacccgctggagctg
tgctaccagtcgcttcacgagtgcggcatgggtgtaatcgctgatggcccgctgctcgat
tgcctgcgccgcgccgtgaccttcggcttgttcctggtgcggctggatgtgcgccaggat
tccagtcgccactcggcggcgatgaccgaaatcaccgattacctgggcctcggtcgctat
gaagactgggatgaagaggcgcgtatcagcttcctgaccaaggagctgagcaatcgtcga
ccgctgctgccgggctatttcaaaccgtcggcggacaccgccgaagtgttgaatacctgc
aaggaaatcgccgccgcaccggccgcgtctctcggctcgtatgtgatctcgatggcgggc
gccgcctcggacgtgctggcggtgcaactgctgcttaaagagtcgggcgtacaacgaccg
atgcgcgtggtcccgctgttcgaaaccctggccgacctggataacgccgggccggtgatg
gagtgtctgctgcaattgccgggctatcgcgcgcgcttgcatgggccgcaggaagtgatg
atcggctactcggactcagccaaggacgccggcaccacggctgccgcctgggcgcagtac
cgggcgcaggaacgtttggtggatatctgccgtgagcagcaggtggaattactgttgttc
cacggtcgtggcggcactgttggccggggtggtgggccagctcacgcggcgatcctgtcg
caaccgccgggctcggtagcggggcgttttcgcaccaccgaacaaggcgaaatgatccgc
ttcaagttcggcctgccggacatcgccgagcagaacctcaatctgtacctggccgcggtg
ctggaagccacgctgttgccaccgccgccgcccgagccggcctggcgccatttgatggac
gaattggcggcagacggtgtcagcgcttaccgcgccgtcgtgcgcgaaaatccccagttc
gtcgagtacttccgccagtccacgccggagcaggagttgggccgtttgccgttgggcagt
cgcccggccaagcggcgtgcgggcggtatcgaaagcctgcgggcgattccgtggattttc
ggttggacccaaacccgcctgatgctacccgcctggcttggctgggaagctgcattaagc
aaggcgctggagcgcggcgagggcgagttgctggggcagatgcgcgagcaatggccgttc
tttcgcacccgcatcgatatgctggaaatggtgctggccaaggccgatgccgacatagcg
cgtttatatgacgagcgtctggtgcagcctgaccttctgccattgggtgcgcacttacgc
gacctattgtcgcaggcgtgcagtgtggtccttggcctgactggccagtcgcaactgctg
gcccacagtccggacaccctggagtttatccgtttgcgtaacacctacctcgacccgctg
cacctgttgcaggccgagttgctggcgcgctcgcgtcagcaggaggcggcgcaggatagc
cctctggaacaggcgctgctggtgtccgtggcgggtattgccgccggattgcgcaacacc
ggttaa

DBGET integrated database retrieval system