KEGG   Pseudomonas antarctica: A7J50_2075Help
Entry
A7J50_2075        CDS       T04830                                 

Definition
(GenBank) Penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
panr  Pseudomonas antarctica
Pathway
panr00550  Peptidoglycan biosynthesis
panr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7J50_2075
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A7J50_2075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:panr01011]
    A7J50_2075
Enzymes [BR:panr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A7J50_2075
Peptidoglycan biosynthesis and degradation proteins [BR:panr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A7J50_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Gly_acyl_tr_N
Motif
Other DBs
NCBI-ProteinID: ANF85492
UniProt: A0A172YZG2
LinkDB All DBs
Position
2242444..2244336
Genome map
AA seq 630 aa AA seqDB search
MPEPIPIKDHEKENRLVNKRLFACALLVIGITCALVGRMYFLQVVQYDYHSTISENNRVH
VLPITPTRGLIYDRNGVVLADNRPSYNLIITRERTTDLKGELDAIVNLLHLPAEDRAVFD
KALKQARHPFVPVTLFYELTEEQIAVLAVNEFRLPGVDVEPQFVRHYPLGAHFAHSIGYV
GRINEKESKALDSVEYRGTQSIGKTGIERFYESELHGHVGYEEVETNAQGRVLRVLKHTD
PIPGKNIVLSLDVKLQEAAEEALGDRRGSVVALDPQTGEVLAMVSKPSFDPNLFVTGISF
KEYAALHDSIDRPLFNRVLRGLYAPGSTIKPEVAIAGLDSGVVTAQTRVFDPGYYQLPDF
DHKYRNWNHSGDGWVDMDAAIMRSNDTYFYDLAHKLGIDRLHDYLAEFGLGQKVSLDMFE
ESAGLMPSQAWKRATRRQPWFPGETVILGIGQGYMQVTPLQLAQATALIANKGVWNRPHL
AKTINGVPPVDENPMPNVVLKDPRDWEQVNHGMQLVMHDPRGIARAAALGAQYRIAGKSG
TAQVVAIKQGERYNRNKTLERHRDNALFVGFAPAEHPKIVISVMIENGEAGGRVAGPVVR
QIMDAWLLDQEGHLKPQYATPAKAPGDPHV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccgataccgatcaaggatcacgaaaaagaaaaccgtctggtcaacaagcgt
ttgttcgcctgcgcgctgttggtaattggcattacttgcgccctggtcgggcgcatgtat
ttcctgcaggttgtgcagtacgactaccactcgacgatttctgaaaacaaccgcgtccac
gtattgccgattacgccaactcgcggcctgatttatgaccgtaatggcgtggttctggct
gacaaccgccccagctataacctaattatcactcgcgagcgcaccactgaccttaagggc
gaattggacgccatcgtcaacctgctgcatttgccggcagaagatcgcgcggtgttcgac
aaagcgctgaagcaggcccgccatcctttcgtgcccgttacgttgttctacgaattgacc
gaagaacagatcgccgtattggctgttaacgagttccgcctgcccggtgtcgacgtcgag
ccgcaattcgtgcgtcattatccgctgggtgcgcatttcgcccattcgattggctacgtc
ggccggatcaatgaaaaagaatccaaggcgctcgattcggtggagtaccgtggcacccag
tctatcggcaagaccggtatcgagcgcttctacgagtccgaactgcacggccatgtcggc
tatgaagaggtcgagaccaatgcccagggccgcgtattacgcgtgctcaagcacaccgat
ccgatccccggcaaaaacatcgtcctgagcctcgatgtcaaactccaggaagccgccgaa
gaagccttgggcgatcgccgtggttcggtcgtcgcccttgacccgcaaaccggcgaagtg
ctggccatggtcagcaagccgagctttgacccgaacctgttcgtcaccggcatcagcttc
aaggaatacgctgcgctgcacgactccatcgatcggccgctgttcaaccgcgtactgcgc
gggctttacgcgcccggttcgacgatcaaaccggaagtggccatcgcgggtctagacagt
ggtgtggtgaccgcgcaaacacgagtgttcgaccccggttactaccagttgcccgatttt
gaccacaaataccgcaactggaaccacagcggcgatggctgggtggacatggacgcggcc
atcatgcgctccaatgacacctacttttacgacctggcccacaaactggggattgaccgc
ctgcacgactacctggccgaattcggtctgggtcaaaaagtctcactggatatgttcgaa
gagtcggccggcttgatgccttcccaggcctggaagcgtgcgacacggcgtcaaccctgg
ttcccgggcgaaaccgtaatcctcggcattggccagggttacatgcaggtcacgccgttg
caactggcgcaggccactgcgttgatcgccaacaaaggtgtatggaaccggccgcacttg
gccaagaccatcaatggcgtgccgcccgtggacgaaaacccgatgcctaacgtggttctg
aaagatccgcgtgattgggaacaggtcaaccacggcatgcaactggtgatgcacgacccg
cgtggtatcgctcgtgcggcggcgcttggcgcccaataccggattgccggcaagagtggt
accgcgcaggtggtggcaatcaagcaaggtgagcgctacaaccgtaacaagacccttgag
cgccatcgtgacaacgccctgttcgttggcttcgcgccggctgaacacccgaaaatcgtg
atctcggtgatgattgagaacggcgaggccggtggccgcgtggcaggccctgtggtgcgg
caaatcatggatgcctggctgctcgatcaagaaggccacctgaagccgcaatatgcgacg
ccggccaaagcgccaggtgacccgcacgtctaa

DBGET integrated database retrieval system