KEGG   Pseudomonas antarctica: A7J50_2741Help
Entry
A7J50_2741        CDS       T04830                                 

Definition
(GenBank) Putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
panr  Pseudomonas antarctica
Pathway
panr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:panr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    A7J50_2741
Enzymes [BR:panr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A7J50_2741
DNA repair and recombination proteins [BR:panr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A7J50_2741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANF86139
UniProt: A0A172Z2B3
LinkDB All DBs
Position
complement(3015909..3018383)
Genome map
AA seq 824 aa AA seqDB search
MAKPLSEYNRKRDFEITAEPAGDAPAGKRKASALSFVIQKHDARNLHYDFRLELDGVLKS
WAVPKGPSLDPSQKRLAVHVEDHPLSYGTFEGSIAPGQYGAGDVIVWDRGVWQPHDEPHK
AYAAGKLKFTLVGEKLSGDWALVRTRLKGSGDKEQWLLIKEKDPQARPTADYDIVQDQPK
SVLSGAVVGTPKPPKKREKAPTALPEQLTPQLATLVDRAPPGDWRYEIKFDGYRMLTRIR
DGEVRLFTRNGNDWTDRLPRQVKALQALKLKDSWLDGEVVSLNADGLPDFQALQNAFDIG
RSLDIVYYLFDAPFLQGQDLREAPVEERRAALKSALSGSRSKLLRFSEAFTANQRDIFES
ACDLALEGVIGKRAGSPYVSSRSADWIKLKCRLRQEFVIVGYTRPQGSRSGFGALLLAVN
DDAGLVYAGRVGTGFDQAALKSIYAQLTPLQRKTSPLEQPLTRTQARGVHWVEPSLVGEV
NFTEWTREGVVRQASFVALRTDKPATQINREQPRKAKSLTKATPARSASSAVNITHPDRV
IDPQSGTQKQQLAAYYDSISEWILPFLRHRPVSLLRAPQGIEGEQFFQKHSERLAIAHIK
QLDQKLDPGHARLMEIDTASALIGAVQMGTVELHTWGATSDHIETPDLFVLDLDPDPALP
WKTMLEAAQLTLSVLDELGLQAFVKTSGGKGLHLVVPLARRDGWETVKAFAKAIAQFMAL
QLPERFSATSGPKNRIGKIFIDYLRNARGASTVAAYSVRARPGLPVSVPVSREELKGLRG
AQQWTIANLHLRLNNLKGDPWTGYAHRQKISKTMWDKLGAKPPQ
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccctgagtgaatacaaccgcaagcgcgattttgagatcaccgcagagccc
gcaggcgacgcgcctgctggtaaacgcaaggcttcggccctgtcattcgtgattcaaaaa
catgacgcccgcaacctgcactacgactttcgcctggagctcgatggcgtacttaaaagt
tgggcggtgccgaaggggccgagcctcgaccccagccagaaacgcctggcggttcacgtt
gaagaccaccctctgagctacggcacctttgaaggcagtattgcgcccggccaatatggt
gccggggatgtgattgtgtgggatcgcggtgtctggcaaccccatgacgagccgcacaag
gcgtatgcggccggcaaactcaagttcaccctggtcggtgaaaaactttccggcgattgg
gcgctggtccgcactcggctcaagggcagcggcgataaggaacagtggttgctgatcaag
gaaaaggacccgcaggccaggccgaccgctgactacgacatcgtccaggaccagccgaaa
agtgtgctcagcggcgccgtggttggtactcccaagccgccaaagaaacgcgagaaagcg
cccactgccctgcccgaacaactcaccccgcaattggcgaccctggttgaccgcgcaccg
cccggcgactggcggtatgaaatcaaattcgacggttaccgcatgctgacacgcatacgc
gacggtgaggtgcgcctgtttacccgcaacggcaatgactggaccgaccgcttgccgcgt
caagtcaaagcgctgcaagccctcaagctcaaggacagctggctggacggcgaagtggtc
agcctcaatgccgacggcttgccagacttccaggcgctgcaaaatgcgttcgatatcggc
cgcagcctggacatcgtctattacctgttcgacgcgccttttctgcaagggcaagatctg
cgcgaagcccccgtggaggaacgccgtgccgcgctcaaatccgcgctgtccggcagccgc
agcaaattgctgcggttctccgaagcctttaccgccaaccagcgcgacatcttcgaaagc
gcctgcgacctggcactggaaggcgtaatcggcaagcgcgcaggcagcccttatgtttcc
agccgcagtgccgactggatcaaactcaagtgccgcttgcgccaggagttcgtgattgtc
ggctacacgcgcccccaaggctcacgcagtgggtttggtgcgctgctgctggcggtcaat
gacgacgccgggctggtctatgccggacgcgtaggtaccgggtttgatcaggcggcgctg
aagtcgatctacgcgcagctcacgccgctgcaacgcaaaacctcaccgctggaacagccc
ttgacccgcactcaggcacgcggtgtgcactgggttgaaccctcgctggtcggcgaagtg
aatttcaccgaatggacccgcgaaggcgtggtgcgccaggcgtcattcgttgcgttgcgc
accgataagccggcgacgcagatcaatcgtgagcagccacgtaaggccaagtccctcacg
aaggctacgccggcgagaagcgccagcagcgctgtgaacatcacccaccccgaccgcgtg
attgacccgcaaagtggtacacaaaaacagcaattggccgcctactacgacagcatcagt
gaatggatcctgcccttcctgcgccaccggcccgtctcgctgctgcgtgcaccgcaaggc
atcgagggcgagcagttcttccaaaagcactctgagcgactcgccattgcgcatatcaaa
cagctggaccagaagctcgacccgggccatgcacgcctgatggaaatcgacacggcgagc
gccctgatcggcgccgtgcagatgggcacggtcgagctgcatacctggggcgccacctcg
gaccacatcgaaacccccgacctgtttgtacttgacctggacccggacccggcactgcct
tggaaaaccatgctggaagcagcgcaactgacactgtcggtattggatgagcttgggctc
caggccttcgtcaagaccagcggcggtaaaggtctgcacctggttgtaccgctcgcgcgc
cgggatggctgggagaccgtgaaggcgtttgccaaagccatcgcgcagttcatggcgctg
caattgcccgaacgctttagtgctacctcgggcccaaagaaccggatcggcaagatcttt
atcgactacctgcgcaacgcgcgtggcgcgagcaccgtcgccgcctattcggtcagggca
cgacctggcttgccggtatcggtaccggtgagtcgagaggaattgaaagggttacgcgga
gcccaacagtggacgatcgccaacctgcacctgcggttgaacaacctcaagggcgatccg
tggaccggttatgcgcaccggcagaagatcagcaagacgatgtgggacaagctgggcgcg
aaaccaccgcagtga

DBGET integrated database retrieval system