KEGG   Pseudomonas antarctica: A7J50_2754Help
Entry
A7J50_2754        CDS       T04830                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
panr  Pseudomonas antarctica
Pathway
panr00250  Alanine, aspartate and glutamate metabolism
panr00410  beta-Alanine metabolism
panr00430  Taurine and hypotaurine metabolism
panr00650  Butanoate metabolism
panr01100  Metabolic pathways
panr01110  Biosynthesis of secondary metabolites
panr01120  Microbial metabolism in diverse environments
panr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A7J50_2754
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A7J50_2754
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A7J50_2754
   00430 Taurine and hypotaurine metabolism
    A7J50_2754
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A7J50_2754
Enzymes [BR:panr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A7J50_2754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANF86152
UniProt: A0A172Z1D4
LinkDB All DBs
Position
3033246..3034676
Genome map
AA seq 476 aa AA seqDB search
MALHKTVETQDQAIEDVYSSGSSQHTLPKYRLPDHSTTPSAAYNLVRDELLLDGNSRQNL
ATFCTTWVEPEVKQLMADALDKNMIDKDEYPQTAEIENRCVHIIADLWHAPKSWQTVGCS
TTGSSEAAMLGGLALKWSWKKRREAAGLPTDKPNFVCGPVQICWKKFARYFDVEIREVPL
RGDALGLLPADLREYCDENTIGVVATLGVTFTGIYEPVAALAAELDSMQRDLGLDIPIHV
DAASGGFIAPFIQRTLQWDFVIERVKSINASGHKYGLAPLGVGWVIWRSTADLPEELIFY
VDYLGGNMATFALNFSRPGGEIIAQYYNFLRLGRDGYTRIQQACSDTAQWLASEIVKFAP
LELVYDGKDGLPAVCYKLKDGIDHGFSLYDLSERVRMRGWQIASYPLPSDRQSVVVQRIL
VRHGVSRDLVALLLEDLRKAIAYLQKNPVLNSDAGPSFSHGAIAEPVIPADTPNLA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcacaaaaccgtagaaactcaagaccaagccatcgaagatgtgtattcgagc
ggctcgtcccagcacaccttgcccaagtaccgtttgcctgatcactcgactacgccgtcg
gcggcctacaacctggtgcgcgatgagctgttgcttgacggcaactcgcggcagaacctg
gcgaccttctgcaccacgtgggtcgagcccgaagtgaagcagttgatggccgatgccctc
gacaagaacatgatcgacaaggacgagtacccgcaaaccgccgagattgaaaaccgttgc
gtgcacatcatcgccgacctctggcatgcgcccaaatcctggcaaaccgttggctgttcg
accacaggttccagtgaagccgccatgcttggtggcctggccctgaagtggagctggaag
aagcgtcgtgaagccgctggcctgccgaccgacaaaccgaacttcgtgtgcggcccggtg
cagatttgctggaaaaaattcgcgcgttattttgatgtggaaattcgtgaagtgcccttg
cgcggtgacgccttgggcctgcttccggccgacctgcgagaatattgcgacgagaacacc
atcggcgtggtcgcgaccttgggcgtcaccttcacgggtatctacgagcctgtcgccgcg
ttggccgccgagttggactcgatgcagcgcgatctcggcctggatatcccgatacatgtt
gatgcggcgagtggcgggtttatcgccccgttcatccagcggacgctgcaatgggacttt
gtgatcgaacgggtcaaatcgatcaacgcgtcgggccacaagtacgggctggcgccgctt
ggcgtgggctgggtcatttggcgttccaccgccgacttgccggaagagctgatcttctac
gtggattatctgggcggcaatatggcgaccttcgccctgaatttcagccggccgggcggt
gaaatcattgcccagtactacaacttcctgcggctcgggcgtgatggctatacgcgtatt
cagcaggcctgctccgacacggcgcaatggctcgcctcggaaatcgtcaaattcgccccg
ctggagttggtgtacgacggcaaagacgggctgccggcggtctgttacaaactcaaggac
ggcattgaccatggattcagcctgtatgacctgtccgagcgcgtgcgcatgcgcggttgg
cagatcgcgtcgtacccgctgccgtcagatcgccagagcgtcgtggtgcagcgcatcctg
gtccgccatggcgtgagccgcgacctggtggcgctgttgcttgaagacctgcgcaaggcc
attgcctacttgcagaaaaacccggtgttgaattccgacgccgggccgagcttcagccac
ggtgcgattgctgagccggtcatcccggccgacaccccgaacctcgcctga

DBGET integrated database retrieval system