KEGG   Pseudomonas antarctica: A7J50_3157Help
Entry
A7J50_3157        CDS       T04830                                 

Definition
(GenBank) glutathione metabolism protein
Organism
panr  Pseudomonas antarctica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG TrbC DUF3094
Motif
Other DBs
NCBI-ProteinID: ANF86543
UniProt: A0A172Z1V5
LinkDB All DBs
Position
complement(3480847..3481269)
Genome map
AA seq 140 aa AA seqDB search
MNDLLSVYAICVLVLCLKMFAISCYQGFFRIRGLAFTNVEDAALFSRAARSEELAPVSRA
KQAWANDLENIPLFFAVGGLCVALGSAEVVTGWLFGCFTLARVAHTVTYLTGLQPWRTLT
YAVGVVCLFGLGSQVVARLI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacctgttgagtgtctacgcaatctgcgtgctggtgctgtgcctgaagatgttt
gcgatctcctgctatcaggggttcttccgaattcgtgggctggcgttcaccaatgttgaa
gatgcagcgctcttcagccgcgccgcgcgatcagaggagctggcgcccgtcagtcgagcg
aaacaggcctgggccaatgacttggagaacattccgctgttttttgcagtgggtgggtta
tgcgtggcgctgggcagtgccgaggttgtcactggctggctatttgggtgttttaccctg
gcccgggtggcgcacacggtaacctatctgacggggcttcagccctggcgcacgctgacg
tacgcagtgggcgtggtttgtctgttcgggctgggcagccaggtggttgccaggctgata
tga

DBGET integrated database retrieval system