KEGG   Pseudomonas antarctica: A7J50_3180Help
Entry
A7J50_3180        CDS       T04830                                 

Definition
(GenBank) class C beta-lactamase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
panr  Pseudomonas antarctica
Pathway
panr01501  beta-Lactam resistance
panr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:panr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7J50_3180
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A7J50_3180
Enzymes [BR:panr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     A7J50_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ANF86565
UniProt: A0A172Z1Y1
LinkDB All DBs
Position
3512948..3514090
Genome map
AA seq 380 aa AA seqDB search
MNHTLQKILISALLLGSGTCMADADIRQVVDTSVVPLMQQQGIPGLSIAVVNKGKAQYFN
YGVANKDTQQPVTEDTLFEIGSVSKTFTATLGGYTQATGKLKLSDKASEHLSALAGSAFD
QISLLQLATYTPGGLPLQFPDAADSAENMLGYFQHWKPTYAPGAQRLYSNPSIGLFGYLS
AQSLGQPFNVAMQKTLLPKLGLTNTHVSVPADKSGQYAQGYDKLQKPVRVSPGALDSEAY
GIKTSTQDLAHYVMVNMHPQTLEKPLQQAIAATHAGYYTVNGMTQGLGWERYPYPITLNA
LLDGNSTPMAMEPHKVTWLTPAQPQPANVLYNKTGSTGGFGAYVVYVPSKDMGVVILANK
NYPNAERVKLAYTILSAMDH
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacacactacaaaaaatactgatatcggccttattgctcggctccggcacctgc
atggcagacgccgatattcgccaggtcgtcgacaccagcgtcgtacctttgatgcaacaa
caaggcatccccggcctgtccatcgccgtggtcaacaaaggcaaggcgcaatactttaac
tacggcgtagcgaacaaagacacacaacagccggtgaccgaggacaccctgtttgaaatc
ggttcagtgagcaaaaccttcaccgccaccctcggcggctatacccaggcgaccggcaag
ctcaagctctcggacaaggccagcgagcacctgtccgcactggccggcagcgccttcgac
cagattagcctgctgcaactggcgacctacacgccaggcggcttgcccctgcagtttccc
gacgccgccgacagcgccgagaacatgctgggctacttccagcattggaaaccgacttac
gcaccgggcgcgcaacgcctgtattccaacccgagcatcgggctgttcggctacctctcg
gcgcaaagccttggccagccgttcaacgtggccatgcagaaaaccctgctgcccaaactg
ggcttgaccaacacccacgtcagcgtgcccgccgacaaatccggccagtacgcccaaggc
tatgacaagctccagaaacccgtgcgcgtgagccctggcgcactcgacagcgaagcctac
ggcatcaagaccagcacccaggacctggctcactacgtgatggtgaacatgcacccgcaa
accctggaaaagccgctgcaacaagccatcgcagcgactcacgccggttactacaccgtg
aacggcatgacccagggcctgggttgggaacgctacccctacccgatcacgctgaacgca
ttgctggacggcaactccacgccaatggcaatggagccgcacaaggtcacttggctgaca
cccgcacaaccgcagccggccaatgtgctctacaacaaaaccggctcaaccggtggtttt
ggggcgtacgtggtgtacgtgccgagcaaggacatgggtgtggtgattctggcaaacaag
aactacccgaatgctgagcgggtcaagttggcctatacgatcttgagcgcgatggaccac
taa

DBGET integrated database retrieval system