KEGG   Pseudomonas antarctica: A7J50_3349Help
Entry
A7J50_3349        CDS       T04830                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
panr  Pseudomonas antarctica
Pathway
panr00010  Glycolysis / Gluconeogenesis
panr00052  Galactose metabolism
panr01100  Metabolic pathways
panr01110  Biosynthesis of secondary metabolites
panr01120  Microbial metabolism in diverse environments
panr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:panr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7J50_3349
   00052 Galactose metabolism
    A7J50_3349
Enzymes [BR:panr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A7J50_3349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ANF86727
UniProt: A0A172Z2K2
LinkDB All DBs
Position
3732546..3733694
Genome map
AA seq 382 aa AA seqDB search
MKHPRHLLSGLALSMMIASGGVQAAGLTSEQKPFGKTNDGTAVEQYVLRNSHGMQATVIT
YGGVLQSLKVPDKNGKAEDVVLGFDDVQGYQAGSAFFGATIGRFGNRLAGGAFELDGKHY
QVPLNDGPNSLHGGAQGFDKHVWQAKPVKGKDSVGVTLTYLSKDGEMGFPGNLKTEVTYS
LNDNNELHIDYTATTDKPTVLNLTNHSYFNLAGAGNGDILKHVATLHASHYTPVNATLIP
TGELAPVKGTPMDFLKPTPIGQHIKDDHPQLKFAEPKQGGFDFNWALDTQGDIKKLAAEV
HDPASGRHLQLYTTEPGVQFYTSNFLDGTVKGKAGKTYQHWSGFTLETQHFPDAPNQPKF
ASTRLNPGQTYSQNTILKFTAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgtcacctgctttccggccttgccctttccatgatgattgccagcggc
ggtgtccaggccgcaggcctcaccagcgagcaaaaacccttcggcaaaaccaatgacggc
accgccgtcgaacagtacgtgttgcgcaacagccatggcatgcaagccacggtcatcacc
tacggcggcgtgttgcagtcgctgaaagtaccggataaaaacggcaaggccgaggacgtg
gtgctcggttttgacgatgtacagggttaccaggccggcagcgcattttttggcgcgacc
atcgggcgctttggcaaccgcctcgcgggcggcgccttcgaactcgacggcaagcactat
caggtaccgctcaacgacggccccaactcgctgcatggcggcgcacagggtttcgacaag
cacgtgtggcaagccaagccagtcaagggcaaggactcggtcggcgtgaccctcacttac
ttgtccaaagacggcgagatgggcttcccgggcaacctgaaaaccgaggtcacgtacagc
ctcaacgacaacaacgaactgcacatcgattacacggccaccaccgacaaacccacggtg
ctcaacctcaccaaccacagttacttcaacctcgccggcgcgggcaacggcgacatcctc
aagcacgtcgcgaccttgcacgccagccactacacgccggtgaatgccaccttgattcct
accggcgaactggcgccggtcaagggcacgccgatggacttcctcaaacccacgccgatc
ggccagcacatcaaggacgaccatccgcagctcaaattcgccgagccgaaacagggcggg
tttgacttcaactgggcgctggacacccagggcgatatcaaaaaacttgccgccgaagta
cacgacccagcgtctggccggcatttacagctctacaccaccgagcctggcgtgcagttt
tataccagcaacttcctcgacggcacggtcaagggcaaggccggcaagacttaccagcac
tggagcggtttcaccctggagacccagcactttccggatgcgcctaaccagccgaagttt
gcgtcgacacgcctgaacccgggccagacctacagccaaaacaccatcctgaagttcacc
gccaagtaa

DBGET integrated database retrieval system