KEGG   Pseudomonas antarctica: A7J50_4108Help
Entry
A7J50_4108        CDS       T04830                                 

Definition
(GenBank) flagellar assembly protein FliO
  KO
K02418  flagellar protein FliO/FliZ
Organism
panr  Pseudomonas antarctica
Pathway
panr02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:panr00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    A7J50_4108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:panr02044]
    A7J50_4108
   02035 Bacterial motility proteins [BR:panr02035]
    A7J50_4108
Secretion system [BR:panr02044]
 Type III secretion system
  Flagellar export apparatus
   A7J50_4108
Bacterial motility proteins [BR:panr02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    A7J50_4108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliO
Motif
Other DBs
NCBI-ProteinID: ANF87469
UniProt: A0A172Z651
LinkDB All DBs
Position
complement(4535446..4535886)
Genome map
AA seq 146 aa AA seqDB search
MKYSMAGLFLALPLSALAAEPVAQAAAAAPVVSSGIGGQLTQLVLGLLLVVGLIFVLAWL
MRRVQRIGPGNGQVIEMIGSRALGPRDRLVLVQVGEEQILLGITPGRITPLHVLKSPVEV
ARTEAATPEFAQRLMELLGKDQKDKK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattcgatggcgggactgtttctggcgctgccattgagcgccctggcggctgag
ccggtcgcgcaagcggcggctgcggcgcccgtagtcagcagtggcatcggcgggcaattg
acccagttggtgctcggtctgttgctggtggtggggttgatctttgtattggcctggttg
atgcgccgcgtgcagcgcatcggcccgggcaatggccaggtgatcgagatgatcggctcg
cgtgcactcggcccgcgtgaccgtctggtgctggtgcaagtcggcgaggagcagattctg
ctcggcatcacgcctggccgcatcaccccgctgcacgtgctcaagtcgccggtcgaagtg
gccaggaccgaggccgccacgccagaattcgcccagcgcctgatggagttgctgggcaag
gatcagaaggataagaagtaa

DBGET integrated database retrieval system