KEGG   Pseudomonas antarctica: A7J50_4622Help
Entry
A7J50_4622        CDS       T04830                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
panr  Pseudomonas antarctica
Brite
Enzymes [BR:panr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A7J50_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANF87971
UniProt: A0A172Z6P9
LinkDB All DBs
Position
5080114..5080710
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVEAFWN
LVNWKFVAEQFEGKTFTA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccctacgcacacgatgccctgcagccgcacatctcc
aaggaaaccctggagtatcaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtgccaggcaccgagttcgaaggcaagaccctggaagagatcgtcaagtcttct
tcgggcggcatcttcaacaacgccgctcaggtctggaaccacactttctactggaactgc
ctggcgccaaacgccggcggtcaacctaccggcgcactggctgaggcgatcaacgctgca
ttcggttcgttcgacaagttcaaagaagaattcaccaagacttccgtcggcaccttcggt
tccggttggggctggctggtgaaaaaagctgacggttccctggccctggccagcaccatc
ggcgccggcaacccgctgaccagcggcgataccccgctgctgacctgcgacgtctgggaa
cacgcttactacatcgactaccgcaacgtgcgtccaaagtatgtggaagcgttctggaac
ctggtcaactggaagttcgtggctgagcagttcgaaggcaagaccttcactgcctaa

DBGET integrated database retrieval system