KEGG   Pseudomonas antarctica: A7J50_5750
Entry
A7J50_5750        CDS       T04830                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
panr  Pseudomonas antarctica
Pathway
panr02025  Biofilm formation - Pseudomonas aeruginosa
panr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:panr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A7J50_5750
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    A7J50_5750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:panr02044]
    A7J50_5750
Secretion system [BR:panr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A7J50_5750
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_22 Bax1-I DUF2383
Other DBs
NCBI-ProteinID: ANF89080
UniProt: A0A172Z991
LinkDB
Position
complement(6300943..6304443)
AA seq 1166 aa
MKAFFSFMIRWVIPLLGLIALSLIIWFVGPLLDVLVPEGRRWALIILVFAVWIAYRVFRI
IQARRQAAEVMRSLAAETPADPNSVATAEELSTLRQRMDEALTLLKKAKLGGDERRNLYE
LPWYVIIGPPGSGKTTALVNSGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAG
RYTTQDSNSTVDKAAWLGFLDLLKKQRSRRPIDGAFIAISLSDLLLGSDAERAAHAAAIR
LRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDNLSKEDRAQVWGMTFALDDGKNSDSP
LAHLQSEFAGLEQRLNERLVERLQQERDPARRDLIYGFPQQFGALKDCLQSFLEGVFKPN
AYEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQSGTGRSYFIEKLFTAV
AFAERGLVGVNPKVERRRKWIARGVLAATVALVVVVSSLWWVSYRANQAYITQVDQKVAP
LGQTVQNLSPAQREVLAVLPLLNAVKNLAGDSPSWSEGLGLYQGDMLEAESASVYRKLLI
AVFAPRLVTRIEEQLHGGGNSDFLYEGLKAYLMLADNEHYDPDFIKAWIALDWDRSLPRD
LPADQRQALTGHLQALFERHPPSARLDPRLIDDLRRQLQQLPVAQRVYDRVKRQKLPDGI
PDFRINEAAGRDAALVFSRKSGKPLGEPLSGFFTAKGYRQAFLLSSLNQTGTLAEEQWVL
GREQADQQNVASLAADVRRLYFQDYQRQWDALLADIDFVPITSVAQAADVLRVISGPTSP
LKKLLVAVAKETDLQAEERQLAAKGVPVEGGVDKLKERLGSLLGQEQQTTSTAQAADDPV
TAHFAELNSIVSKNEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQAAAAATR
VSLNAERQPPLVQGMVKSVVNSTTNSMMGGVRNQLNAAWVSEVVNVYRQSLAGRYPMSPG
SARDATLDDFGQFFGVGGVMDNYFRKYLQPYVDTSAPTWRWQPGAAQKLGIAPGVLQTFQ
RAAAIRDAFFRAGGTQPIVRFELKPVSMDPTITQFLLDLDGQQLSYDHGPSRPVAMQWPN
PGSIGVVRISIMPPSASGRSGVTLDGPWAWFRLLEQSDLTAGNSPDRFNLRLRVDGASIA
YELRANSAFNPFKSRVLSGFSLPERL
NT seq 3501 nt   +upstreamnt  +downstreamnt
gtgaaggcgtttttcagtttcatgattcgctgggtgatcccattgctgggcctgatcgcc
ctcagcctgatcatctggtttgtcgggccgttgctcgacgtcctggtgccggaagggcgc
cgttgggcgctgattatcctggtgtttgccgtgtggatcgcttaccgcgtgttccgcatt
atccaggcccggcgtcaggccgccgaagtgatgcgcagcctagcggccgaaacaccggcc
gaccccaacagcgtcgccactgccgaagagttatcaaccctgcgtcagcgcatggacgaa
gccctcacgctgctgaaaaaggccaagctcggcggtgacgagcgccgcaacctctacgag
ctgccgtggtacgtgatcatcggcccgccgggttcgggcaagaccaccgcgctggtcaat
tccggcctgcattttccgctggccgcgcaattgggcgccggtgcggtgcgaggcgttggc
ggtacgcgcaattgcgactggtggtttaccgatcaagcggttttgctcgacaccgctggc
cgctacaccacgcaggacagcaactccacggtggataaagccgcgtggctgggcttcctt
gacctgctgaaaaagcagcgctcgcgccgcccgatcgatggcgcctttatcgcgatcagc
ctgtccgatttgctactgggcagcgacgccgagcgcgccgcgcatgccgctgcgattcgc
ctgcgtatccaggagctgtatacccagttgggcgtgcgtttcccgatctacctgatgctg
accaagctcgacctggtgccgggcttcatggagtttttcgacaacctgagcaaggaagac
cgcgcccaggtgtggggcatgacctttgccctggatgacggcaagaacagcgacagcccg
ttggcccatctgcaaagcgaatttgcaggcctggagcagcgccttaacgaacgcttggtg
gaacgcttgcaacaggagcgcgacccggcgcggcgcgacctgatctacggcttcccgcag
cagttcggtgcgttgaaggattgcctgcaaagcttccttgaaggcgtgttcaagcccaat
gcctatgaagagcgcgtattgctgcgcggcgtgtacttcaccagcggcacccaggaaggc
agcccgattgatcgcctgatcggcgccatggcccagagcatgaacctggaccgccagcac
ctggcgcgccagagtggtaccgggcgcagttacttcatcgaaaaactgttcaccgccgtg
gcgttcgccgagcgtgggctggtgggggtgaacccgaaggtcgagcggcggcgcaagtgg
atcgcacgcggcgtattagccgctaccgtggccttggtggtggtggtgagcagtttgtgg
tgggtgagttatcgcgccaatcaggcctacatcacccaagtcgatcagaaggtcgcgccg
ctgggccagacggtacagaacctcagcccggcgcagcgcgaagtcctcgccgtgctgccg
ttgctcaatgcggtgaagaacctcgcgggtgattcgccgagttggtccgaagggctgggt
ctgtatcaaggcgacatgctcgaagccgagtccgccagtgtctaccgcaagctgttgatc
gccgtattcgccccccgtctggtgacgcgtatcgaagaacaactgcacggcggtggcaat
tccgacttcctctatgaaggcctgaaggcttacctgatgctcgccgacaacgagcattac
gacccggacttcatcaaggcctggatcgccctcgactgggaccgtagcctgccgcgtgac
ctgccggccgatcagcgccaggcgttgaccgggcatttgcaggcgctgttcgagcgccat
ccgccgagcgcgcgactcgacccacggctgatcgacgacctgcgtcgccaactgcaacaa
ctgccggtggctcagcgcgtctatgaccgcgttaaacgccagaaactgcccgacggcatt
cctgacttccgtatcaacgaagccgcaggccgtgatgccgcgctggtgttcagccgtaaa
agtggcaagccgctgggcgagccgttgagtgggtttttcaccgccaagggctatcgtcag
gcgttcctgctgagcagcttgaatcagacgggcaccctggctgaagagcaatgggtgctg
ggccgcgaacaggcagaccagcaaaacgtggcgagcctcgccgccgacgtgcgccgcctg
tatttccaggattaccagcgccagtgggatgccttgcttgcggatatcgactttgtgccg
atcaccagcgtggcccaggcggccgatgtgctgcgagtgatttccggcccgacgtcgccg
ctgaaaaaactgctggtggcggtggccaaggaaactgatctgcaagccgaagagcgccaa
ttggccgccaaaggcgtgccggtggaagggggtgtcgacaagctcaaggagcgcctcggc
agcctgctcggccaggagcaacagaccaccagcactgcgcaagcggcggatgatccggtg
accgcgcatttcgctgaactcaacagcatcgtcagcaagaatgaaggcgaaccggccgcc
atcgacggcctgctcgcggatatgaacgcgctgtatgtgcaggtcagcgccatggtcggt
gccagtggcgatgccttgctcggcgaggcgaagaaccaggcggcggcagcagccacgcgg
gtcagcctgaatgccgagcgccagccgccgttggtgcagggcatggtcaagtcggtggtc
aactccaccaccaacagcatgatgggcggcgtgcgcaaccaactgaacgcagcgtgggtc
agcgaagtggtcaacgtgtaccgccagtccctggccggtcgttatccgatgtcgccgggc
agcgcgcgcgacgccacgctggatgactttggccagttttttggtgtgggcggggtgatg
gataactacttccgcaaatacctgcagccttatgtggacacgtctgcgccgacctggcgc
tggcagccgggggcggcgcagaagctcgggattgcgccgggcgtgctgcaaaccttccag
cgtgcggcggccattcgtgatgcgttcttccgcgctggaggcacccaaccgattgtgcgt
ttcgaactcaagccggtgtcgatggacccgacgatcactcagttcctgctggatctggac
ggccagcaattgagctacgaccacggcccaagccgcccggtggccatgcaatggccgaac
ccgggcagcattggcgtggtgcgtatttctatcatgccgccgtcggccagcggccgttcg
ggcgtgaccctggacgggccgtgggcctggttccgcctgctggagcaatcggatctcacc
gccggtaactcgccggaccgcttcaacctgcgcctgcgggtggacggggcgagtatcgcc
tacgagttgcgcgccaacagcgccttcaacccgttcaagagccgtgtactcagcggcttc
agcctgccggagcggttatga

DBGET integrated database retrieval system