KEGG   Pantoea sp. SO10: FCN45_04500Help
Entry
FCN45_04500       CDS       T06053                                 

Gene name
aroL
Definition
(GenBank) shikimate kinase AroL
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pans  Pantoea sp. SO10
Pathway
pans00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pans01100  Metabolic pathways
pans01110  Biosynthesis of secondary metabolites
pans01130  Biosynthesis of antibiotics
pans01230  Biosynthesis of amino acids
Module
pans_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pans00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FCN45_04500 (aroL)
Enzymes [BR:pans01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     FCN45_04500 (aroL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA_5 AAA_28 AAA_16 AAA AAA_25 RNA_helicase AAA_14 PduV-EutP AAA_22 Cytidylate_kin tRNA_lig_kinase Sigma54_activ_2 Rad17 AAA_17 CoaE
Motif
Other DBs
NCBI-ProteinID: QCP58678
LinkDB All DBs
Position
991093..991617
Genome map
AA seq 174 aa AA seqDB search
MSLPIYLIGARGCGKTTVGQALSQALGYAFNDTDHYLQLTTQRSVAEIVASEGWDSFRAR
ETESLRAVTAPNTVIATGGGMVLAEVNCRFMREHGQVIWLNAPADVLADRLEHQPEAAQR
PTLTGRPIAEEMGDILRERAHLYRQTAHHEVNAMQSPDRVVEQILQSLSLARAS
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcattacccatctatctgatcggcgcacgcggttgcggtaaaaccacggttggccag
gcgctgtcgcaagcgctgggctatgcctttaacgataccgatcactatttgcaactcact
acgcaacgcagcgtggcggagattgtggcatctgaagggtgggatagcttccgcgcccgc
gaaacggaatcgctgcgcgcggtcaccgctccgaatacggtcatcgccaccggcggcggc
atggtgttggcggaagtgaattgtcgctttatgcgcgaacacggccaggtgatttggctg
aacgcgcctgcagacgtgctggccgatcgtctggaacatcagccggaagccgcgcagcgt
cccaccttaaccggccgcccgattgccgaagagatgggcgatattttgcgtgagcgtgct
catttgtatcgccaaaccgcgcatcatgaagtcaacgcgatgcaatcgcccgatcgcgta
gtagagcaaattctgcaatcgctctctttagcgcgcgccagctaa

DBGET integrated database retrieval system