KEGG   Pantoea sp. SO10: FCN45_10270Help
Entry
FCN45_10270       CDS       T06053                                 

Gene name
fabI
Definition
(GenBank) enoyl-ACP reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pans  Pantoea sp. SO10
Pathway
pans00061  Fatty acid biosynthesis
pans00780  Biotin metabolism
pans01100  Metabolic pathways
pans01130  Biosynthesis of antibiotics
pans01212  Fatty acid metabolism
Module
pans_M00083  Fatty acid biosynthesis, elongation
pans_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pans00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FCN45_10270 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FCN45_10270 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FCN45_10270 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pans01004]
    FCN45_10270 (fabI)
Enzymes [BR:pans01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FCN45_10270 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FCN45_10270 (fabI)
Lipid biosynthesis proteins [BR:pans01004]
 Fatty acid synthase
  Component type
   FCN45_10270 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: QCP59738
LinkDB All DBs
Position
2205669..2206457
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILITGVASKLSIAYGIAQAMHKQGAELAFTYQNDKLKSRVEEFAKDLGSDIV
LPCDVAEDESITALFTELAKTWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
AYSFVAMAKECRAMLNPNSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GTRVNAVSAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLAGGI
TGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctgattactggcgttgccagtaaactctcaatc
gcctacggtattgcgcaggcgatgcacaaacagggcgcagaactggctttcacctaccag
aacgacaaattgaaaagtcgtgtggaagagtttgctaaagatctgggttcagacattgtt
ctgccatgcgatgtggctgaagacgagagcatcactgcgctgttcaccgaactggcaaaa
acctggccgaaatttgacggtttcgttcactccatcggtttcgcacctggcgatcagctg
gatggcgactacgtgaatgctgttacccgtgaaggcttcaaaatcgctcacgacatcagc
gcgtacagctttgtggcgatggcgaaagagtgccgtgcaatgctgaacccgaattctgcc
ctgctgaccctgtcttacctgggtgcagagcgcgctatcccgaactacaacgtgatgggt
ctggcgaaagcgtcactggaagctaacgtgcgctacatggcgaacgcgatgggtccagaa
ggcacgcgtgttaacgccgtttctgccggtccaatccgtacgctggctgcatcaggcatc
aaagatttccgtaaaatgctggcgcactgcgaagcggttaccccgattcgtcgtaccgtt
actattgaagacgtgggtaactcagctgcattcctgtgctctgatctggcgggtggtatc
accggtgaagtggtacacgttgatggcggcttcagcattgccgcaatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system