KEGG   Pantoea sp. SO10: FCN45_10295Help
Entry
FCN45_10295       CDS       T06053                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
pans  Pantoea sp. SO10
Brite
KEGG Orthology (KO) [BR:pans00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pans03016]
    FCN45_10295
Enzymes [BR:pans01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     FCN45_10295
Transfer RNA biogenesis [BR:pans03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    FCN45_10295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: QCP59743
LinkDB All DBs
Position
2213016..2214950
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKEKLHAQTPRVEGVVKGTEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRI
SAVIHTDKDRESAEPETLVEPFLTRFVGRVQKKDDRLSIVPDHPLLKEAIQCRAERGVTH
DFQNGDWAVAEMRRHPLKGDRGFYAELTEFIVTADDHLAPWWVTLSRHNLERQAPDVGFG
EMLDENLQREDLTALNFVTIDSASTQDMDDALYVEEAADGNLILTIAIADPTAYVAEGSE
LDKLASKRAFTNYLPGFNIPMLPRELSDDVCSLRPNERRPALACRVTVLKDGSLADDVHF
FAAWIESKAKLVYDEVSDWLENSGSWQPENDAIAQQIRLLHQVCLARSEWRQTHALVFKD
RPDYRFVLGEKGEVLDIISEPRRIANRIVEESMILANVCAAKVLQEKLGFGIYNLHTGFD
LANAEQAAGVLAGHGITVDPQAITTLEGFRQLRRQLDAQPTQYLDSRIRRFQSFAEVGTE
PGPHFGLGLEAYATWTSPIRKFGDMINHRLLKAIVRGESTGRPQDELTTIMSERRRLNRM
AERDVGDWLYARFLAPFAATDRKFSAEIIDVSRGGMRVRLLENGAVAFIPAPFIHAMRDE
LVCSQESGTVQIKGEVAYRVTDIIDVTIAEVRMETRSVVARPAA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggataatccgctgctcgcgcagcttaaagagaagcttcacgcgcagactccg
cgcgtcgaaggtgttgttaaaggtacggaaaaaggctttggcttcctcgaagttgatgcc
cagaaaagctacttcattccgccaccgcagatgaagaaagtgatgcacggcgaccgtatt
tcggccgtgatccacaccgataaagaccgcgagagtgccgagccggaaaccctggttgag
ccgttcctgacccgctttgtcggccgcgtgcagaagaaagacgatcgcctgtcaattgtg
ccggatcatccgctgctgaaagaggcgattcagtgccgcgccgaacgtggcgtgactcac
gatttccagaacggcgattgggcggtagcagagatgcgtcgtcacccgctgaaaggcgat
cgcggtttctatgctgaactgaccgaattcattgtcactgcggacgatcacctcgcgccg
tggtgggtaacgttgtcgcgccataacctcgaacgtcaggctccggacgtcggttttggt
gagatgctcgacgaaaatctgcagcgtgaagatttgaccgcactgaacttcgtcaccatc
gacagcgccagcacccaggatatggatgatgcgctgtacgtggaagaggctgccgacggc
aatctgatcctgaccatcgctatcgccgatccaaccgcttacgtggcagaaggcagcgag
ctggataagctggcgtcgaaacgcgcgttcaccaactatctgccgggcttcaacattccg
atgctgccgcgcgaactctctgacgacgtctgttccctgcgtccgaacgagcgtcgtccc
gcgctggcttgtcgcgttaccgtgctgaaagatggcagcctggctgatgacgtgcatttc
tttgctgcgtggatcgagtcgaaagccaagctggtttatgacgaagtttctgattggctg
gaaaacagcggcagctggcagcctgaaaacgacgccattgctcagcagattcgcctgctg
catcaggtttgcctggcgcgcagcgaatggcgtcaaacccacgcgctggtgtttaaagat
cgtccggactaccgctttgtgttgggcgaaaaaggcgaagtactggatatcatctccgag
ccacgtcgcatcgcgaaccgcatcgttgaagagtcaatgattctggctaacgtctgtgcc
gcgaaagtgctacaggagaaactgggcttcggtatctataacctgcacaccggtttcgat
ctggccaatgctgagcaagccgctggcgtgctggcgggtcatggcatcaccgtggatccg
caggcgattaccacgctggaaggcttccgccagctgcgtcgtcaactcgatgcgcagcca
acccagtatctggatagccgcattcgtcgcttccagtcgtttgcagaagtcggcaccgag
ccgggcccgcactttggtcttggcctcgaagcctacgcgacctggacttcgccgattcgt
aagttcggcgacatgatcaaccatcgcttgctgaaggcgatcgtgcgcggtgaaagcact
ggccgtccgcaggatgagctgaccaccatcatgagcgaacgtcgtcgcctgaaccgcatg
gccgagcgcgatgttggggactggttgtatgcccgcttccttgcaccgtttgccgctacc
gatcgcaagttcagcgccgagatcatcgacgtgtctcgcggcggcatgcgcgttcgtctg
ctggagaatggcgcggtagccttcattcctgcgccgttcatccacgcgatgcgtgatgag
ctggtgtgctcgcaggaaagcggcaccgtgcagataaaaggtgaagtcgcttaccgtgtc
actgacatcatcgacgtgaccatcgccgaagtgcgtatggaaacccgcagcgtggtcgcg
cgtcctgccgcctga

DBGET integrated database retrieval system