KEGG   Pantoea sp. SO10: FCN45_11590
Entry
FCN45_11590       CDS       T06053                                 

Gene name
tssK
Definition
(GenBank) type VI secretion system baseplate subunit TssK
  KO
K11893  type VI secretion system protein ImpJ
Organism
pans  Pantoea sp. SO10
Brite
KEGG Orthology (KO) [BR:pans00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pans02044]
    FCN45_11590 (tssK)
Secretion system [BR:pans02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   FCN45_11590 (tssK)
SSDB
Motif
Pfam: T6SS_VasE Glutaredoxin2_C
Other DBs
NCBI-ProteinID: QCP59986
LinkDB
Position
complement(2491411..2492751)
AA seq 446 aa
MKTEQPLWGRGTMISPQHFQQQSAWQAWQSECIARMGLNQPWGVLQAEFEPEALKRGRLQ
PRHLHLRFSDGTLVDTNNADPLPPTLTLEAEQKEVTVVLALPQLYANGGNCLQESDVAER
PVRFRQRWRDIRNLFGDDTRQVAVLQPELTLRYAHQDNSDWLTCPVARLQQDAQGGWVLD
SQFLPPLLTLQSSPWLMTALEQLVTQLRARLVRLMAMRRESNQRMADFAVADVSLFWLLN
ALNSAEPLLADFQRHPQSPPERLYPELARLAGSLLTFSLEHQVSAIPAYRHENLNEVFPQ
LFSLLGTLLEASLPSRMVAIDMTHDSRLRQWQARLNDPRLREEADFYLSVRSPLPVAQLQ
EQFPRQCKVGSPDDVTALVNSSQLGIPLKPLSHVPAAVPLRLENQYFSLDLSHPAARAML
ESGSCVFYVPGTLGDPELELFAVLRS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaaacagaacaaccactctggggccggggcacgatgatctcgccccagcactttcag
cagcagtccgcctggcaggcgtggcaaagtgaatgcatcgcgcgcatggggcttaatcag
ccgtggggcgtgttgcaggcggagtttgagccggaagcgttaaagcgcggacgtttgcaa
ccgcgtcatctccatctgcgcttcagtgacggcacgctggtggatacaaacaacgccgat
ccgctgccaccgacgctgacgcttgaggcggagcagaaggaagtgacggttgttctggcg
ctgccgcagctgtacgccaacggcggcaactgcctgcaggagagcgacgtggcggagcgt
ccggtacgattccgtcagcgctggcgcgatatccgcaacctgttcggggacgacacccgg
caggttgcggtattgcagcctgaactgacgctacgttatgcacatcaggacaacagcgac
tggctgacctgtccggtggcgcgtctgcagcaggatgcgcagggcggttgggtgctggac
agccagtttctgccgccactcctgaccctgcaatccagcccgtggctgatgacggcactt
gaacaactggtgacgcagctgcgtgcacggctggtgcgtctgatggcgatgcgccgcgaa
agcaaccagcgcatggccgattttgccgttgccgacgtatcgctgttctggctgctcaac
gcgctaaacagcgccgagccactgctggccgattttcagcgtcatccgcaaagcccgccg
gaacggctttatcccgaactagcgcgcttggcgggtagtctactgacgttctcgctggag
catcaggtgagcgccattccggcttaccgccatgaaaatttgaatgaggtgttcccacag
ctgttcagcctgctcggcacgctgctggaagccagcctgccgtcgcgcatggtggcaatc
gacatgacgcacgacagccgtctgcgtcagtggcaggcgcgcctcaacgatccacgcctg
cgcgaggaagccgatttctacctgtcggtgcgctcgccgctgccggtggcgcagctgcag
gagcagttcccgcgccagtgcaaagtcggcagtccggatgacgtgactgcgctggtgaac
agctcgcagctcggcattccgctcaagccacttagccacgttcctgcggcggtcccgttg
cgactggagaaccagtatttctcgctggatctgtcccatccggcggcacgcgcgatgctc
gagagcggcagctgcgtgttttacgtccccggcacgctgggtgacccggaactggaactg
tttgcggtgctgagatcatga

DBGET integrated database retrieval system