KEGG   Pantoea sp. PSNIH1: PSNIH1_00765Help
Entry
PSNIH1_00765      CDS       T03464                                 

Definition
(GenBank) sulfurtransferase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00040  Pentose and glucuronate interconversions
pant01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSNIH1_00765
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     PSNIH1_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AIX48891
LinkDB All DBs
Position
complement(126694..127728)
Genome map
AA seq 344 aa AA seqDB search
MKALVLTQAGHIAIEDREFDEVLGDNDVKIKIHSVGICGSDVHYYKHGRIGPFVVEAPMV
LGHEAAGIVLEIGKNVTHLKAGDRVCMEPGIPDMHSDQSRAGLYNLDPAVRFWATPPVHG
CLRETVIHPAAFTFKLPENVSFREGAMVEPLAVAMQAATKAGIKPGDIGLVLGAGPIGVV
TALAALAGGCSDVIICDMFDEKLAVAAAYEGLHAVNIKTGDLAGKVSELTSGNGADVVFE
CSGAKPAIATLAEHAAPGATVILVGMPVDAAPMDIVAAQAKELTFKTIFRYANMYPRTLR
LLSSGKLRVEPLISHTYKFADSVEAFDRAAAGHAADIKIMLEME
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttagttctgactcaggcaggccacattgcgattgaagatcgggaatttgat
gaagtgctgggtgataacgatgtcaaaattaaaattcactcggtagggatttgcggcagc
gatgttcactactacaaacatggccggattggtccgtttgtggtggaggcaccgatggtg
ctgggtcatgaagccgctggcattgtgctggagatcggtaaaaacgtgacgcacctgaag
gcgggcgatcgcgtctgtatggagccagggatcccggatatgcactccgatcagtcgcgc
gccggtctctacaatctcgatcccgccgtgcgcttctgggcaacgccgccggtacatggc
tgcctgcgtgaaacggtcattcatcctgcggcgttcacgtttaagctgccggaaaatgtc
agcttccgcgaaggggccatggtggagccgctggcggtggcgatgcaggccgcgaccaaa
gccggcatcaaacccggcgatatcggcctggtgctgggggccggtccgatcggcgtggtc
acggcgctggcggcgctggcaggcggctgttccgatgtcatcatctgcgacatgtttgat
gaaaagcttgccgtggcggcagcgtatgaagggctgcacgccgttaacatcaaaaccggc
gatctggccggtaaagtttctgaactgaccagcggtaacggcgcagatgtggtgtttgag
tgcagcggggccaaaccggctattgccacgctggcggaacacgcggcgccgggtgcgacc
gtcattctggtgggcatgccggtggacgccgcgccgatggatattgttgcggcacaggct
aaagagctgaccttcaaaacgatttttcgctacgccaatatgtatccccgcacgctgcgc
ctgttaagcagcggcaagctgcgggtagagccgctgatcagccacacctataaattcgcc
gacagcgttgaagcgtttgaccgcgcagccgccggccatgcggcggatatcaaaatcatg
ctggagatggagtga

DBGET integrated database retrieval system