KEGG   Pantoea sp. PSNIH1: PSNIH1_01935Help
Entry
PSNIH1_01935      CDS       T03464                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pant  Pantoea sp. PSNIH1
Brite
KEGG Orthology (KO) [BR:pant00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSNIH1_01935
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PSNIH1_01935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C DiSB-ORF2_chro FAM72 PALP ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AIX49094
LinkDB All DBs
Position
complement(367822..368907)
Genome map
AA seq 361 aa AA seqDB search
MNILPQQIKSLVNYGPRDYRLETLPLPEPKARELLVKVGACGICASDVHCWHGAPMYWGD
GNPEKAWVKTPVVVGHEFYGTVVGYGEGALEHFGVSPGDRVIAEQIIPCNQCRFCKDGKY
WMCEKHDIYGFQTQDSDGGMTEYMLFKANSRVHKIPDTLTHEECALIEPFACAVHAVNRA
AIEFNDVVVLAGAGPLGTGMIQAIRLKNPKLFIVLDTIPERLALAKKLGADLVFNPLEQD
VDAEVRKLTDGYGCDIYIEATGNPLAVNQGLQMIRRMGRYVEFSVFGKPATVDWSIIGDR
KELDVRGSHLGPHCYETVISFFEKKWFTAEGIVTHSFPLAEWEQGFAMASGRESIKVLLV
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctgccgcaacagatcaaaagcctggtgaactatggcccgcgcgattatcgc
ctggaaaccttaccgctgcctgagccaaaagcacgcgagctgctggtaaaagtgggagca
tgtggtatctgcgcgtctgacgtccactgctggcacggggcgccaatgtactggggagat
ggtaatccggaaaaagcctgggttaaaacgccagtagtggtggggcatgagttttatggc
acggtcgtcggatatggcgagggcgcgctggagcattttggcgtgtcgcctggcgaccgc
gtcatcgctgaacagattattccctgtaatcagtgccgcttctgcaaagatggcaaatac
tggatgtgcgaaaagcacgacatctacggctttcagacgcaggactctgatggcggtatg
accgaatatatgctgttcaaagccaacagccgggtgcataaaattcctgatacgctgacg
cacgaagagtgcgcgctgattgagcccttcgcctgtgcggtccacgcggtgaaccgcgcg
gcgattgaattcaatgatgtggtggtgctggcaggggctggcccgctcggcaccggcatg
attcaggctatccgcctcaaaaaccccaagctgtttattgtactggataccattccggaa
cgtctggcgctggcgaaaaagctgggggccgatctggttttcaacccgctggagcaggat
gtggatgcggaggtgcgcaaactcactgacggctacggctgcgacatctatatagaggcg
accggcaacccactggcagttaatcagggactgcagatgatccggcgcatgggccgctat
gtcgagttcagcgtgtttggtaagcctgcaacggtagactggtcgatcattggcgaccgc
aaagagctggatgtgcgcggctcacatcttggcccgcactgctatgaaacggtcataagc
ttttttgagaaaaaatggttcaccgcagaaggcattgttacgcacagttttccgctggcg
gagtgggagcaggggtttgcgatggcatcaggtcgcgaatcgatcaaagtgctgctggta
ccctga

DBGET integrated database retrieval system