KEGG   Pantoea sp. PSNIH1: PSNIH1_04755Help
Entry
PSNIH1_04755      CDS       T03464                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00564  Glycerophospholipid metabolism
pant01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PSNIH1_04755 (glpD)
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PSNIH1_04755 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: AIX49600
LinkDB All DBs
Position
949295..950803
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAVDAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRMGLFMYDRLGKRTTLPGS
KGLRFGAESALKPEITRGFEYSDCWVDDARMVVLNAQEVERKGGEVRTRTRVNRAWREGG
MWMVEAEEVDTGKILTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVKIDEEETRYLLKVFNAHF
KKQLTSDDIVWSYSGVRPLCDDESDSPQAITRDYTLDVRDDNGGAPLLSVFGGKLTTYRK
LAEHAMEKLAKYYPNAGPAWTKNAVLPGGDFSGTREDYAAGLRRRYPFISENMARHYART
YGSRTEMLLEGATSLTDLGENFGHEFYEAELRYLVKNEWVRELDDAIWRRTKQGMWLNTA
QQARISEWLARNSQKPALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtgatcggcggcggcatcaacggagccggcattgcagtg
gacgctgcaggacgcggactgtctgtgctgatgctggaggcgcgggatctggcgtgtgcc
acctcctccgccagttccaaactgattcacggcggcctgcgctaccttgaacactacgag
tttcgtctggttggcgaagcgctggccgagcgtgaagtgctgttaaaaatggcgccgcat
atcgctttcccgatgcgcttccgcctgccgcaccgcccgcacctgcgtccggcgtggatg
atccgtatgggcctgtttatgtatgaccgcctcggcaagcgcactacgctgccgggcagt
aaaggtctgcgctttggcgcggagtcggcgctgaagccggaaattacgcgcggttttgaa
tattccgactgctgggtggatgatgcccgcatggtggtgctgaacgcgcaggaagttgag
cgtaaaggtggcgaagtgcgcacccgtacccgcgttaaccgcgcatggcgtgaaggcggc
atgtggatggttgaggcagaagaggtcgataccggcaaaattctgacctggcgcgctaaa
ggcctggttaatgcggccggcccgtgggttaaacagctgtttgacgacggcctgaagctg
aaatccccttatggcattcgccttattaaaggcagccatatcgtggtgccgcgcgtgcac
accgaaaagcaggcttatattctgcagaacgaagataaccgtatcgtgtttgttattccg
tggatggatgagttctctatcatcggtaccaccgacgttgagtacaaaggcgatccgaaa
aacgttaaaattgatgaggaagagacgcgctatctgctgaaggtgtttaacgcgcacttc
aaaaagcagctgacctcagatgatatcgtctggagctactccggcgtgcgtccgctgtgt
gatgatgagtcagattcaccgcaggcgatcacccgtgactatacgctggacgtgcgtgat
gataacggcggggcgccgctgctgtcggtgtttggcggcaagctgactacctatcgcaag
ctggcagagcatgcgatggagaaactggcgaagtactacccgaacgccggcccggcctgg
acaaaaaatgccgtgctgccgggtggtgatttctccggtacgcgtgaggactacgctgcc
ggtctgcggcgccgctatccctttatcagcgaaaacatggcgcggcactatgcccgcacc
tacggcagtcgcaccgaaatgctgcttgagggtgccaccagcctgaccgatctgggcgag
aattttggtcatgagttctatgaagctgaactgcgttatctggtcaaaaacgagtgggta
cgtgaactggatgatgctatctggcgccgtaccaagcagggtatgtggctgaacacggcc
cagcaggcgcgcatcagcgagtggctggcgcgcaacagccagaagccggcgctttcgctc
gcatcgtaa

DBGET integrated database retrieval system