KEGG   Pantoea sp. PSNIH1: PSNIH1_04985Help
Entry
PSNIH1_04985      CDS       T03464                                 

Definition
(GenBank) xylose isomerase
  KO
K00457  4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00130  Ubiquinone and other terpenoid-quinone biosynthesis
pant00350  Tyrosine metabolism
pant00360  Phenylalanine metabolism
pant01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PSNIH1_04985
   00360 Phenylalanine metabolism
    PSNIH1_04985
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PSNIH1_04985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pant04147]
    PSNIH1_04985
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     PSNIH1_04985
Exosome [BR:pant04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSNIH1_04985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AIX49642
LinkDB All DBs
Position
complement(1006157..1006954)
Genome map
AA seq 265 aa AA seqDB search
MPGNPLFLNLVLLQGEPAAKLRAAQDAGFDQAEIWREDVEKMETAHLAHSAIRFTNLQVL
RDFTGAPDSERQQKREELQQFIRLARAIGCDTIQAPATTRQDCIPERIDDDLRWLAAEAA
SHEMRIMYEPMAWSSVDNTLPLAWQRLQRLDLPNVGLVVDLFHICALGGDASHLEGIPAS
RIYEVQLCDMAEQPPQNNQALSDYARHQRLLPGDGIIDVASFVSRLQRAGYAGPVGIEVF
NDQLKAQPAAESARRAWQALNRCWR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcaatccactttttcttaatctggtcctgctgcagggcgagcctgcagcaaag
ctgcgcgcggcgcaggatgcagggtttgatcaggctgaaatctggcgcgaggatgtagaa
aagatggagacggcgcacttagcgcactccgcgatccgtttcactaatctgcaggtgctg
cgcgattttaccggcgcgccggacagcgagcgccagcaaaagcgtgaggagctgcagcag
tttatccggctggcgcgtgcgattggctgcgacaccatccaggcgcctgccaccacgcga
caggattgcatcccggaacgcattgatgacgatctgcgctggctggcggcggaagcggcg
agccatgagatgcgcatcatgtatgagcctatggcgtggagtagcgtggacaatacgctg
ccgcttgcctggcagcgcctgcagcgtcttgatctgcctaatgttggcctggtggtggat
ctgtttcatatctgcgcgctgggtggtgacgcgtcgcaccttgagggcatcccggccagc
cgtatctatgaagtccagctgtgcgatatggctgaacagccgccgcagaataatcaggcg
ctgagcgactatgcgcgtcaccagcggctgctgccgggcgacggcattattgatgtggcc
agctttgtcagtcgcctgcagcgagccggttatgctggtccggttggcattgaagtattc
aatgaccagctgaaagcgcagccggcggcagagagcgcacggcgcgcctggcaggcgctg
aatcgctgctggcgctaa

DBGET integrated database retrieval system