KEGG   Pantoea sp. PSNIH1: PSNIH1_10470Help
Entry
PSNIH1_10470      CDS       T03464                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00010  Glycolysis / Gluconeogenesis
pant00260  Glycine, serine and threonine metabolism
pant00680  Methane metabolism
pant01100  Metabolic pathways
pant01110  Biosynthesis of secondary metabolites
pant01120  Microbial metabolism in diverse environments
pant01130  Biosynthesis of antibiotics
pant01200  Carbon metabolism
pant01230  Biosynthesis of amino acids
Module
pant_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pant_M00002  Glycolysis, core module involving three-carbon compounds
pant_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSNIH1_10470 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    PSNIH1_10470 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSNIH1_10470 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pant04131]
    PSNIH1_10470 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pant04147]
    PSNIH1_10470 (gpmA)
Enzymes [BR:pant01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PSNIH1_10470 (gpmA)
Membrane trafficking [BR:pant04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PSNIH1_10470 (gpmA)
Exosome [BR:pant04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PSNIH1_10470 (gpmA)
  Exosomal proteins of melanoma cells
   PSNIH1_10470 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIX50621
UniProt: A0A0A0Z2K1
LinkDB All DBs
Position
complement(2187347..2188099)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKTWRLNERHYGALQGLDKAETAAKYGDDQVKQWRRGFA
ITPPELDRSDERFPGHDARYKSLTEAQLPTTESLALTIDRVIPYWNETILPRIKSGEKVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaactaagctggttctggtccgtcacggcgaaagccagtggaatcaggaaaac
cgcttcaccggatggtatgatgtggatctctctgacaaaggtcgtaccgaagcgaaagcg
gcgggtcagctgctgaagaaagagggcttcgtgttcgatttcgcctatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggatgaactggatcaggcctggctgccg
gtagagaaaacctggcgtctgaatgagcgtcactacggtgcgctgcaggggctggataaa
gcagaaaccgcggctaaatatggtgatgaccaggttaagcagtggcgtcgtggttttgcc
attactccgccagagctggatcgcagcgatgagcgtttccccggccacgatgcgcgttac
aaatcactgaccgaggcgcagctgcctaccaccgagagcctggcgctgaccatcgaccgc
gttatcccttactggaacgaaaccattctgccgcgcattaaaagcggtgagaaagttatc
attgccgcacacggtaactcgctgcgcgcgctggtaaaatatctcgataacatgagcgaa
gatgagatcctcgaactgaacatcccgaccggcgtgccgctggtgtatgagttcgatgaa
aacttcaagccaatcaaacactactatctgggtgatgccgatgagatcgcagcgaaagcc
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system