KEGG   Pantoea sp. PSNIH1: PSNIH1_18725Help
Entry
PSNIH1_18725      CDS       T03464                                 

Definition
(GenBank) relaxase
Organism
pant  Pantoea sp. PSNIH1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwC AAA_30 Viral_helicase1 UvrD_C_2 PhoH SH3_13 AAA_19 PIF1 AAA Helicase_RecD Torsin Herpes_Helicase Sigma54_activat PDH Fes1
Motif
Other DBs
NCBI-ProteinID: AIX52284
LinkDB All DBs
Position
pKPC-1c5:complement(31288..34524)
Genome map
AA seq 1078 aa AA seqDB search
MLDITTITRQNVTSVVGYYSDAKDDYYSKDSSFTSWQGTGAEALGLSGDVESARFKELLV
GEIDTFTHMQRHVGDAKKERLGYDLTFSAPKGVSMQALIHGDKTIIEAHEKAVAAAVREA
EKLAQARTTRQGKSVTQNTNNLVVATFRHETSRALDPDLHTHAFVMNMTQREDGQWRALK
NDELMRNKMHLGDVYKQELALELTKAGYELRYNSKNNTFDMAHFSDEQIRAFSRRSEQIE
KGLAAMGLTRETADAQTKSRVSMATREKKTEHSREEIHQEWASRAKTLGIDFDNREWQGH
GKPLEADIARNMAPDFTSPEVKADRAIQFAVKSLSERDASFERQKLIQIANKQVLGHATM
ADVEKAYLKAVQKGAIIEGEARYQSTLKVGASVMAETLTRKEWIDSLTNSGMRADKARFA
VDDGIKNGRLKKTSHRVTTVEGIRLERSILTIESRGRGQMPRQLTAEIAGQLLAGKTLKN
EQMRAVTEIVTSKDRFVAAHGYAGTGKSYMTMAAKELLESQGLKVTALAPYGTQKKALED
DGLPARTVAAFLKAKDKKLDEKSVVFIDEAGVIPARQMKQLMEVIEKHNARAVFLGDTSQ
TKAVEAGKPFEQLIKAGMQTSYMKDIQRQKNEVLLEAVKYAAEGNAARALKNITGVNELK
EEAPRLAQLADRYLSLSSEQQDATLIISGTNASRKTLNDYIRGNLGLAGTGETFTLLDRV
DSTQAERRDSRYFSKGQIIIPEQDYKNGMKRGESYQVLDTGPGNKLTVESSSGEQIAFSP
RTHTKLSVYQAVSAELAPGDKVMVTRNDKTLDVANGDRFTVKTVEGEKLTLEDKKGRTVE
LDKKQASYLSYAYATTVHKSQGLTCDRVLFNIDTKSLTTSKDVFYVGISRARHEVEIFTD
DKKSLASSVSRDSPKTTAAEIDRFFGLEARFKDIGRDTSLETRSAEKGLPEATGESMAFN
QKPDEHNMTTGTDYQPVSNAEDAFHLKQNPMDDSVGLRRHEAQQNDAELAHDYAAADDQQ
WSAQEYADYEHYAEASDYDFDSSIYDDYAMPQTSQAEQSHTGKEHTHEHEHEEGGHEI
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatataaccacgattacccgccagaacgtcactagcgttgtgggctactactct
gatgcaaaggatgattactacagtaaggattcatcattcacgtcctggcagggaaccgga
gctgaagccctcggcttatccggggacgttgaatcagcccggtttaaagagctgcttgtc
ggagagatagataccttcacgcatatgcagcgacacgtgggtgatgccaaaaaagagcgt
ctgggctacgacctgacgttttcagcgcctaaaggggtatccatgcaggcgctgatacac
ggcgataaaaccattatcgaggctcatgaaaaagctgttgccgctgctgtgcgtgaagct
gaaaaactcgcgcaggcccggacgactcgccaggggaaatcagtaacccagaataccaat
aaccttgtcgtcgctacttttcgccacgaaacgtccagggcgctagatcctgatttgcac
acccacgcttttgtcatgaacatgacccagcgcgaggacggccagtggcgcgcgctcaaa
aatgatgagctgatgcgtaacaaaatgcacctgggcgatgtttacaaacaggagctggcg
ctggagttgaccaaagccggttatgagctgcgttacaacagcaaaaataacacgttcgat
atggcccatttttcagacgaacagattcgcgctttttcccgccggtcggagcaaattgaa
aagggactcgctgcaatgggcctgacgcgggaaaccgccgatgctcagacgaaaagccgc
gtctcgatggcgacgcgtgaaaagaaaacagagcattcccgtgaagaaattcaccaggaa
tgggccagccgcgccaaaacgctaggcattgattttgataaccgtgaatggcagggacac
ggtaaacctctggaggctgatattgcgcgcaacatggccccggattttaccagccctgag
gttaaagctgaccgggctatccagtttgcagttaagtcgctgtcagagcgcgatgccagc
tttgaacgccagaagctgattcagatcgctaataagcaggtgctgggccatgccacaatg
gccgatgttgaaaaagcgtacctgaaggcggtacagaagggcgccatcatcgagggcgaa
gcccggtatcaatcaacgctgaaggtcggtgcttcagttatggccgaaactctgacgcgc
aaagagtggatcgactcgctgacgaatagcgggatgcgtgcggataaagcccgttttgcg
gtagatgatggtattaaaaacggcaggcttaaaaagaccagccaccgcgtcactaccgtg
gagggtattcgccttgagcgttccattctgactatcgaatcacgcggccgggggcagatg
ccgcgacagctgaccgcagagattgcaggccagctgctcgccgggaaaaccctcaagaat
gagcagatgcgcgcagttacagaaattgtgacgagcaaagatcgttttgtggccgcacat
ggttacgccggtaccggtaaaagctatatgacgatggccgctaaagagctgctggagtca
caagggctgaaggtcacggcgctggccccctatgggacacagaaaaaagcgcttgaagat
gatggattaccggcccgcaccgttgccgccttcctcaaagcgaaggataaaaagctggat
gaaaaatcagtcgtattcattgatgaagccggggttatacccgcccggcagatgaaacag
ctgatggaggtgatcgagaagcataacgctcgcgcggtattcctgggggatacgtcacag
acgaaagcggtagaagccggtaagccttttgagcagctgattaaagcaggtatgcagacc
agctacatgaaagacattcagcgacagaagaatgaagttttgcttgaggcggttaagtat
gccgctgaaggtaatgccgcgcgcgccctgaaaaatatcaccggcgtgaacgaactgaag
gaagaagcgccccgactcgctcaacttgccgatcgctacctgtctctgtcctcagaacaa
caggatgccaccctgataatctctggtacgaacgcctcacgcaaaaccctcaatgactac
atccggggcaatctggggcttgccggaaccggcgaaacgttcacgctacttgaccgcgtg
gattcgacacaggcggaacgccgcgacagccgttatttcagtaaagggcaaatcattatc
cccgaacaggattacaaaaatggtatgaagcggggcgagtcttaccaggttcttgatacc
gggccgggcaacaaattgacggttgaaagcagcagcggtgagcagatcgctttcagcccg
cgtacacacaccaagctgtctgtataccaggcagtcagcgccgaactggcgccgggcgat
aaggtcatggtaacgcgtaacgataaaacgctggacgttgccaacggcgaccgcttcacg
gtgaaaaccgtggagggtgaaaaactgacgcttgaggacaaaaaagggcgcacggttgag
ctggacaaaaaacaggcttcttatctttcctatgcttatgcaaccaccgtccacaaatcc
caggggcttacctgtgatcgcgtgttgttcaacatagataccaaatcgcttaccacttct
aaggacgttttttatgttggtatttcgcgtgcgcgtcatgaggtggaaatttttaccgac
gataaaaaatctttggcatcgagcgtgagccgcgacagcccgaaaaccacggccgcagaa
attgaccgtttctttgggcttgaggccaggtttaaggatattggccgcgataccagttta
gaaacccgatcagctgaaaaaggtctgccagaagccacgggggaaagcatggcgtttaac
cagaaacccgatgaacataacatgacaaccggcactgattatcagccggtgagcaacgca
gaggacgcctttcatcttaagcagaaccctatggatgattccgttggcctgcggcgtcat
gaagcacagcaaaatgatgcagaactggcccatgattatgctgctgccgacgatcagcag
tggagcgcgcaggagtatgccgattacgagcattatgccgaagcatcagactacgacttt
gacagcagcatttacgacgattacgccatgccgcagacgtctcaggcggaacagagccat
accggaaaagaacacacccatgagcatgagcatgaagaagggggccatgaaatctga

DBGET integrated database retrieval system