KEGG   Pantoea sp. At-9b: Pat9b_0194Help
Entry
Pat9b_0194        CDS       T01386                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00071  Fatty acid degradation
pao00280  Valine, leucine and isoleucine degradation
pao00281  Geraniol degradation
pao00310  Lysine degradation
pao00362  Benzoate degradation
pao00380  Tryptophan metabolism
pao00410  beta-Alanine metabolism
pao00640  Propanoate metabolism
pao00650  Butanoate metabolism
pao00903  Limonene and pinene degradation
pao00930  Caprolactam degradation
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
pao01212  Fatty acid metabolism
Module
pao_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Pat9b_0194
   00650 Butanoate metabolism
    Pat9b_0194
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pat9b_0194
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pat9b_0194
   00310 Lysine degradation
    Pat9b_0194
   00380 Tryptophan metabolism
    Pat9b_0194
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pat9b_0194
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pat9b_0194
   00281 Geraniol degradation
    Pat9b_0194
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pat9b_0194
   00930 Caprolactam degradation
    Pat9b_0194
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pat9b_0194
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pat9b_0194
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pat9b_0194
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Pat9b_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ADU67520
UniProt: E6WHK7
LinkDB All DBs
Position
complement(223595..225778)
Genome map
AA seq 727 aa AA seqDB search
MLYQGDTLSVRWLDDGIAELVFDAPGSVNKLDTKTVASLGEALGVLEQQPALRGLLLTSA
KPAFIVGADITEFLSLFDAPVEKLSQWLAFANSIFNRLEDLPVPTVSAIDGYALGGGCEC
VLATDFRIATPQLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVDGNSALK
LGLVDAVVSSDKLRSAALTVLQDAMVQGSWQARRAPKLAPLKLSPIEAAMSFTIAKSMVL
QTAGKHYPAPITAVKTIEAAAGLGRDDALQLETAAFVPLAQSDVARALVGIFLNDQYVKG
VAKKRGNATATPTQAAVLGAGIMGGGIAYQSAWKGVPVQMKDINPQALALGMKEASKLLN
KQLERGKIDGAKLASVLTTIQPTLDYAGFERADVVVEAVVENPQIKAKVLAETEQHLRDD
AILASNTSTIPISLLAQSLQRPENFCGMHFFNPVPRMPLVEVIRGEKTSEETLGKVVAWA
SKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDGADFRQIDKVMEKQFGWPMGPAWLL
DVVGIDTAHHAQQVMAQGFPSRMQKDYRDAIDVLYEAGRYGQKNGLGFWRWTEDKKGKAQ
KQADTEVDTLLQHVCQPKRVFSDEEIANRMMLPMLNEVVRCLEEKIIASPAEADMALIYG
LGFPPFRGGACRYMDTLGNSTVVDQAKRYTVLGPLYALPELLLQKAHQHQSWYPAAQPID
EAALQSA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgataccctttctgttcgctggctcgacgatggcatcgccgagctg
gttttcgacgcgcccggttcggtgaataaactcgataccaaaaccgttgcctcactgggt
gaggcgctgggtgtactggagcaacaacccgcgctgcgcggcctgctgctcacctcagcc
aagccggcgtttattgtcggggccgacatcaccgaatttctttccctgtttgatgcaccg
gtggagaaactgagccagtggctggccttcgccaacagtatttttaatcgtctggaagat
ctgcccgtccctactgtttccgctatcgatggttatgcgctgggcggcggctgtgagtgc
gtattggcaaccgacttccgcatcgcaacgccgcaactgcgtattggcctgccggaaacc
aaactgggcatcatgccgggcttcggcggcagtgtgcgtttaccacgcctgctgggtgcc
gacagcgcactggagattatcgccgcaggtaaagatgtcgatggcaacagcgccctgaaa
ctgggcctggtcgatgccgtcgtcagcagcgacaaactgcgcagcgcggcgttaaccgtg
ttacaggatgccatggtgcagggcagctggcaggcacgtcgcgctccgaaactggccccg
ctcaaactcagcccgattgaagcagcaatgagtttcaccatcgccaaaagtatggtgcta
caaacggcgggcaaacattacccggccccgatcactgcagtgaaaaccattgaagccgca
gcaggtctggggcgcgatgatgccttgcaactggagacggcggcgtttgtgccgttagcg
caaagtgatgtagcacgggcgctggttggtatcttccttaatgatcaatatgttaaaggc
gtggcgaaaaaacgcggcaatgccacagcgaccccaacgcaggcagcagtattgggggcg
ggcatcatgggcggcggtattgcgtatcagtcggcatggaaaggcgtgccggtgcagatg
aaagatatcaatccacaagcgctggcgctcggcatgaaagaagccagtaagctgctgaac
aagcaactggaacgcggcaaaattgatggcgcgaaactggccagcgtgctgaccaccatc
cagccaacgctggactacgccggatttgaacgtgcggatgtggtggtggaagcggtagtg
gaaaacccccagatcaaagccaaagtgctggccgaaaccgagcagcatctgcgcgacgac
gccatcctggcctccaacacctcgaccattccgatcagcctgctggcgcagtcgctgcaa
cgaccggaaaatttctgcggcatgcacttcttcaacccggtgccgcgtatgccgctggtt
gaagtgattcgcggcgaaaaaacgtccgaagaaacgctcggtaaagtcgtcgcctgggcc
agcaagatgggcaaaacgccgattgtggtcaatgactgccccggcttctttgttaaccgc
gtgctgttcccttacttcgcggccttcagcctgctgttacgtgacggtgccgatttccgc
cagatcgacaaagtgatggagaaacagtttggctggccgatgggaccggcatggttgctg
gatgtagtagggatcgataccgctcatcacgcccagcaggtgatggcacagggtttcccc
tcccggatgcagaaagattatcgcgacgccatcgacgtactgtacgaagccggacgctat
gggcagaaaaatggcctcggattctggcgctggaccgaagataaaaaaggtaaagcgcag
aaacaggccgataccgaagtggacacgctgctacagcacgtttgccagccgaagcgcgtc
ttcagcgatgaagagattgctaaccgcatgatgctgcccatgctgaacgaagtggtgcgc
tgtctggaagagaagattatcgcttccccggccgaagcggatatggcgctgatatacggc
ctcggcttcccgccgttccgtgggggtgcctgccgttatatggatacgctcggcaacagc
acagtggttgatcaggctaaacgctacaccgtgctcggtccgctgtatgcgctgccggag
ctgctgctacagaaagcccatcagcatcaaagctggtatcccgcagctcaaccgattgat
gaagccgcgctgcaaagtgcctga

DBGET integrated database retrieval system