KEGG   Pantoea sp. At-9b: Pat9b_1147Help
Entry
Pat9b_1147        CDS       T01386                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao00260  Glycine, serine and threonine metabolism
pao00680  Methane metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
pao01230  Biosynthesis of amino acids
Module
pao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pao_M00002  Glycolysis, core module involving three-carbon compounds
pao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_1147
  09102 Energy metabolism
   00680 Methane metabolism
    Pat9b_1147
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pat9b_1147
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pao04131]
    Pat9b_1147
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pao04147]
    Pat9b_1147
Enzymes [BR:pao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pat9b_1147
Membrane trafficking [BR:pao04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Pat9b_1147
Exosome [BR:pao04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pat9b_1147
  Exosomal proteins of melanoma cells
   Pat9b_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADU68469
UniProt: E6WC53
LinkDB All DBs
Position
complement(1292437..1293189)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKCWRLNERHYGALQGLDKAETAAKYGDDQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLTDAQLPTTESLALTIERVIPYWNDSILPRIKSGEKVI
IAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENFKPLKRYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaactaagctggttctggtgcgccacggcgaaagccagtggaatcaggaaaac
cgcttcaccggatggtacgatgtggatctgtccgataagggtcgcaccgaagccaaagca
gccggtcagctgctgaagaaagaaggtttcgtattcgattttgcctacacctccgtgctg
aaacgtgccatccacaccctgtggaatgtactggacgagctggaccaggcctggctgccg
gttgaaaaatgctggcgtctgaacgaacgtcactacggtgcgttgcagggtctggacaaa
gcagaaaccgctgccaaatatggcgacgatcaggtgaaacaatggcgtcgcggcttcgcg
gtgaccccgccagaactggatcgcagcgatgagcgtttcccgggccacgacccgcgttat
gcatcactgactgatgcccagctgccaaccaccgaaagcctggcactgaccatcgaacgc
gtgatcccttactggaacgacagcattctgccgcgcattaagagcggtgagaaagtgatc
atcgccgcacacggcaactcgctgcgtgccctggtgaaatacctcgacaacctgagcgaa
gacgaaatcctcgaactgaacatcccaactggcgtgccgttggtgtatgaattcgacgag
aacttcaagccgctgaaacgttactatctgggtgatgccgacgagatcgctgcaaaagca
gcagccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system