KEGG   Pantoea sp. At-9b: Pat9b_2054Help
Entry
Pat9b_2054        CDS       T01386                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00061  Fatty acid biosynthesis
pao00780  Biotin metabolism
pao01100  Metabolic pathways
pao01130  Biosynthesis of antibiotics
pao01212  Fatty acid metabolism
Module
pao_M00083  Fatty acid biosynthesis, elongation
pao_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pat9b_2054
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pat9b_2054
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Pat9b_2054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pao01004]
    Pat9b_2054
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Pat9b_2054
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Pat9b_2054
Lipid biosynthesis proteins [BR:pao01004]
 Fatty acid synthase
  Component type
   Pat9b_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ADU69368
UniProt: E6WDR2
LinkDB All DBs
Position
2268063..2268851
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILITGVASKLSIAYGIAQAMHKQGAELAFTYQNDKLKGRVEEFAKDLGSDIV
LPCDVAEDESITALFTELAKTWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
AYSFVAMAKECRAMLNPNSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAVSAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLAGGI
TGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctgattactggcgttgccagtaaactttccatt
gcctacggtattgcgcaggcgatgcacaaacagggcgcagagctggctttcacctaccag
aacgacaaactgaaaggtcgtgtggaagagtttgctaaagatttgggttcagacattgtt
ctgccgtgcgatgtggcagaagacgagagcatcactgcgctgttcaccgaactggcaaaa
acctggccgaaatttgacggtttcgttcactccattggtttcgccccgggcgaccagttg
gatggcgactatgtaaacgccgttacccgtgaaggcttcaaaatcgctcacgacatcagc
gcctacagctttgttgcgatggccaaagagtgccgtgcgatgctgaacccgaactcagca
ctgctgaccctgtcttatctgggcgcagagcgcgcgatcccgaactataacgtgatgggt
ctggcaaaagcgtctctggaagccaacgtgcgttacatggcgaatgccatgggcccggaa
ggcgtgcgtgttaacgccgtgtcagccggtccgatccgtactctggcggcgtcaggcatc
aaagatttccgtaagatgctggcacactgcgaagcggtcaccccgattcgccgtaccgta
actatcgaagacgtgggtaactctgcggccttcctgtgttccgacctggccggtggtatc
acgggtgaagtggtccacgttgatggcggcttcagcattgccgcgatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system