KEGG   Pantoea sp. At-9b: Pat9b_2476Help
Entry
Pat9b_2476        CDS       T01386                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00250  Alanine, aspartate and glutamate metabolism
pao00280  Valine, leucine and isoleucine degradation
pao00410  beta-Alanine metabolism
pao00640  Propanoate metabolism
pao00650  Butanoate metabolism
pao01100  Metabolic pathways
pao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Pat9b_2476
   00650 Butanoate metabolism
    Pat9b_2476
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pat9b_2476
   00280 Valine, leucine and isoleucine degradation
    Pat9b_2476
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pat9b_2476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pao01007]
    Pat9b_2476
Enzymes [BR:pao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Pat9b_2476
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Pat9b_2476
Amino acid related enzymes [BR:pao01007]
 Aminotransferase (transaminase)
  Class III
   Pat9b_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADU69777
UniProt: E6WER4
LinkDB All DBs
Position
complement(2694877..2696193)
Genome map
AA seq 438 aa AA seqDB search
MQNVMAEQQTYSDNSLLLDAREQHVPRGVVTAHPLVIERAKGSEVWDVEGNRYLDFVGGI
GVLNVGHNHPAVVNAVTKQLGLVSHACFQVVAYPGYIELAQRLNQLVGNGQPFKSVFFTS
GAEAVENAVKIARAHTQRSGIIAFDGAFHGRTLLGCTLTGMSQPYKQNFGPFPGEVYRLP
FPNAFYGVSDDDCLQALDQLFAVQIAPERVAAIIIEPVQGDGGFLPAGANFMQALRRVTE
KHGILLICDEVQTGFGRTGKMFAFQHSEITPDLITVAKSLGGGLPISGVVGKAAIMDAPL
PGGLGGTYGGNALGCAAALAVLDLMEHDNLLARSNQLGEKLNAHLHQLAEKYACIGDVRG
VGFMQAVEIIDFETKRPDAAMTQKILDCACQEGLLLIKCGLHRSTIRFLAPLVTTDSQLE
EALHIFDIALARASGRLG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgtcatggcggaacagcaaacatattccgataacagcctgttactggatgca
cgtgagcagcatgtgccgcgtggcgtggtcaccgcacatccgctggtgatcgaacgggcg
aaaggtagcgaggtatgggatgttgaggggaaccgttacctcgatttcgttggtggtatc
ggcgtgttgaacgtcggccataaccatccggccgtggtgaatgcggtcaccaaacagctc
ggtctggtttcgcatgcctgtttccaggtggtggcgtatccggggtatatcgaactggcg
cagcgcctgaaccaactggtcggcaatggtcagccatttaagagcgtgtttttcaccagc
ggtgcggaagcggtagaaaatgcggtgaaaatcgcccgcgcacatacgcagcgctctggc
atcatcgcctttgatggcgcatttcatggccgcaccttgctgggttgtaccctgaccggt
atgagtcagccatataaacagaatttcggccccttcccgggcgaagtgtatcgcctgccg
ttccccaacgcattttacggcgtgagcgatgacgactgtctgcaagcgctggaccagttg
ttcgcggtgcagattgcaccggaacgtgtagcggcgattatcattgaaccggtgcagggc
gatggcggtttcctgccagcaggggctaattttatgcaggcgctgcgccgggtcacggaa
aaacacggcattctgttgatctgtgatgaagtgcagaccggttttggtcgcaccggtaaa
atgttcgctttccagcattcggagattaccccggacctgatcaccgtggcaaaaagcctc
ggcggcggcttgccgatttctggtgtggtggggaaagcggcgatcatggacgcgccatta
cctggcgggctgggcggcacttacggtggcaatgcgctgggctgtgcggcagcgctggcg
gtgctcgacctgatggaacacgacaacctgctggcgcgcagcaatcagctgggcgagaaa
ctcaatgcgcacctgcatcaactggcggaaaaatacgcctgcatcggtgatgtgcgtggc
gtgggctttatgcaggcggtagaaatcatcgattttgagaccaaacgtcctgatgcggcg
atgacgcaaaagatcctcgattgcgcctgtcaggaaggcctgctgttgatcaaatgtggt
ctgcaccgcagtaccatccgcttcctggcaccgctggttaccaccgattcacagctggaa
gaagcgctgcatatctttgatatcgcgctggcacgcgccagtggccgactcggataa

DBGET integrated database retrieval system