KEGG   Pantoea sp. At-9b: Pat9b_3150Help
Entry
Pat9b_3150        CDS       T01386                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00550  Peptidoglycan biosynthesis
pao01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pat9b_3150
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Pat9b_3150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pao01011]
    Pat9b_3150
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pao03036]
    Pat9b_3150
Enzymes [BR:pao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Pat9b_3150
Peptidoglycan biosynthesis and degradation proteins [BR:pao01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Pat9b_3150
Chromosome and associated proteins [BR:pao03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    Pat9b_3150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF3094
Motif
Other DBs
NCBI-ProteinID: ADU70447
UniProt: E6WGN8
LinkDB All DBs
Position
complement(3466812..3468542)
Genome map
AA seq 576 aa AA seqDB search
MPRIKKFLGKDQIQAPFNPFRFRLICLGVLSCLGLLLARVGDLQLINHPMLEHEADQRSL
RTVTLPTNRGTLLDRDGEALALSVPSRDIIADPMRVLESNPDFTSAKWAYMANALNMRPD
QLAQQIVANPKKRFLYLGRKIELSIAKDIAALKLKGISSVYDDSRFYPMSEAAAPLIGIV
GADNNGLNGLEKGFDRLLQGEEGKEVYRQDKNGDIISMIDYQPPQQPPTVQLSIDKFDQY
TLFSKLRDGVLLNKADSGAAVLIKIDTGEILAMASYPSFNPNNYDDATPAQMRNSAINDS
YEPGSTVKPLVVLEGLERHLVRPDSVIDTSPYSVNGHLIRDVGHWPRLTMTGILQKSSDI
GVSHIALAMPAEALVNTYQAFGLGKPTGLGLTGESIGYFPLHRERWADIERATFAFGYGL
RVTPLQIAREYATLGSYGIYRPLSITKVTPPVLGTQVADPQMVQTVVHMLESDVLPGGTG
VKAAVPGYRLATKTGTAEKMGTSGKYDGGYVNYTAGIAPASHPEVALVVMINHPTAGDHF
GGSVAAPVFGNIMGPVLKHMNIAPDAIYSKPPSDKS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgccccgaataaaaaaatttctgggaaaagaccagatccaagctccatttaatccattt
cgctttcgcctgatctgtttgggtgtgctttcctgtctgggtttgttgctggcacgcgtc
ggtgatttacagctgattaaccatccgatgctggaacatgaagcggatcaacgctcatta
cgtaccgtgacgctgcccaccaaccgtggcaccctgctggatcgcgacggcgaagcgctg
gcactcagcgtgccgtcgcgtgacatcatcgctgacccgatgcgagtactggagagcaac
ccggattttaccagcgccaaatgggcctacatggcgaatgcgctgaatatgcgcccggat
cagctggcgcagcagattgtcgcgaacccgaaaaagcgtttcctctatctggggcgcaaa
attgagctgagtattgccaaagatatcgccgcgctgaagctcaaaggcatcagctcggtg
tatgacgacagccgtttctacccgatgagtgaggccgccgcgccgttgattggtatcgtt
ggggcggataacaacgggctgaatggcctggagaaaggttttgatcgcctgttgcaggga
gaagagggcaaagaggtctatcgccaggataaaaatggcgacatcatctcgatgattgat
taccagccaccgcagcagccaccgacggtccagctcagtatcgataaattcgaccagtac
acgttgttcagtaaactgcgtgacggcgtattgctgaataaggcggattcgggtgccgcg
gtgttgatcaaaatcgacaccggggaaattctggcgatggcgtcctatccgtcgtttaac
cccaacaactacgacgatgccaccccggcacagatgcgtaactcggcgattaacgacagc
tatgaacccggttccacggtgaaaccgctggtggtgctggaaggtctggagcgtcatctg
gtgcgccctgactcggtgattgatacctcaccttattcggtgaatggccatctgattcgt
gacgtggggcactggccgcgtctgaccatgaccgggattttgcagaaatcgagtgatatc
ggtgtttcccatatcgcgctggcgatgccagcagaggcgctggtcaacacttatcaggcc
tttggtctgggcaagcctaccggactggggctgaccggtgaaagcatcggttacttcccg
ctccatcgtgaacgctgggcggatatcgagcgagccacctttgccttcggctacggctta
cgtgtcacgccgctgcaaattgcacgtgagtacgccacccttggctcttacggtatttac
cgaccattgtcgattaccaaggtgacaccgccggtgctgggcacccaggtcgccgatcca
caaatggtacaaaccgtggtgcatatgctggagagtgatgtcttgccgggcggcaccggg
gtgaaagcggcggtgccgggttatcgcctggcaaccaaaaccggtacggcagagaaaatg
ggcaccagcggcaagtacgatggcggctacgtcaactacaccgccggtattgcccctgcc
agccatccggaagtcgcactggtggtgatgatcaaccatccaaccgccggggaccacttc
ggtggctcggtcgctgcgccggtattcggcaacattatggggccggtactgaagcacatg
aacattgcgccggatgctatctacagcaaaccgccttcggataaatcttaa

DBGET integrated database retrieval system