KEGG   Pantoea sp. At-9b: Pat9b_3322Help
Entry
Pat9b_3322        CDS       T01386                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00550  Peptidoglycan biosynthesis
pao01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pat9b_3322
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Pat9b_3322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pao01011]
    Pat9b_3322
Enzymes [BR:pao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Pat9b_3322
Peptidoglycan biosynthesis and degradation proteins [BR:pao01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Pat9b_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADU70616
UniProt: E6WAB0
LinkDB All DBs
Position
complement(3657682..3659574)
Genome map
AA seq 630 aa AA seqDB search
MNFRNFEAEEKLFVRRAIVAFALVVICFTILGVNLYHLQVDENSYYATRSNENDIKMIPI
APTRGLIYDRNGIPLVRNVTWYDILLTPYKIDDMKATIAALTPIVDLTPEEIDTFWKNLK
QNSRYKPVVLKEELTDEQVARFAVNQFRFTGVSIDTYQDRQYPYGADLAHVVGYVSKIND
NDYKRLNEAGVGENYAADHNIGKQGIEGYYESILHGKTGYQEVEVDNHGRIVRVLKEVPP
VAGKNIYLTLDLHLQQYVESQLVGQRAAVLIEDPHDGSVLAMVSSPSYDPNPFVKGISYQ
AYKTLLQDKNLPLINRVTQGLYPPASTVKPYMAMSALLTGVITPQTTFFGAPTWTLPGTD
RKYRDWKKSGHGMLDVTRAIEESADTFFYQVAFMMGIDRIHHMLSQFGYGKPTGIDLNEE
YAGLLPSREWKQKVHKKGWYQGDTVSVGIGQGYWIATPIQMVKALVALLNNGRVINPHLL
GKVQLGTTQQPYEAKDPQPQIGDPKSPYWSLVRHAMFGMANAPNGTGYKYFHTAPYGIAA
KSGTSQVFSLRQNQVYNAKMIPTRLRDHIFYTAFAPFNDPKVAVALILENGGNEGITAAP
VMRNILDHIFLPPPAVPVETANIANAPAAR
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccgtaatttcgaagccgaagagaaactgtttgtccgccgcgcgatcgtggcc
tttgcgttggtggtgatctgtttcactatcctcggtgtgaatctctaccatttgcaggta
gatgagaacagctattacgcgacgcgttccaacgaaaacgacatcaaaatgatccccatc
gcgccgacgcgtgggttgatctacgatcgcaacggcattccgctggtgcgtaatgtcacc
tggtacgacatcctgctgaccccttacaaaatcgatgatatgaaggcgaccattgcggcg
ctcaccccgattgtcgatttaacgccggaagagatcgataccttctggaaaaacctcaag
caaaacagccgctacaaaccggtggtgttgaaagaagaactgactgacgagcaggtggca
cgttttgcggtcaatcaattccgcttcacgggcgtgagcattgatacctatcaggatcgc
caatacccctatggtgctgacctggcgcatgtggtcggctatgtgtcaaagatcaacgat
aacgactacaaacgcctgaacgaagcgggggtcggtgagaactatgccgctgaccacaac
atcggtaagcagggcattgaaggctattacgaatcgattctgcacggcaaaacgggttat
caggaagtggaggtcgataaccacggccgcatcgtgcgcgtgctgaaagaagtgccgcct
gtggccgggaaaaatatctatctgacgctggacctgcatttacaacagtatgtcgagagc
caactggtggggcagcgcgccgccgtgctgattgaagatccccatgatggcagcgtactg
gcgatggtctccagccccagctatgacccaaacccgtttgtgaaagggatcagctatcag
gcgtacaaaaccctgttgcaggataagaatctgccgctgattaaccgtgtcacccagggg
ctttatccgccagcttcgacggtgaaaccctatatggcgatgtcagcgttgttaaccggt
gtcatcaccccgcaaaccaccttctttggcgcaccaacctggacgttgccgggcaccgat
cgtaaataccgtgactggaaaaaaagcggtcacggcatgctggatgtgacgcgcgcgatt
gaggagtcagccgataccttcttttatcaggtggcgtttatgatgggcattgatcgtatc
catcatatgcttagccagtttggctatggcaaaccgaccggaatcgatcttaacgaagag
tacgccggactgctgccgagccgtgaatggaagcaaaaagtccataaaaaaggatggtat
cagggcgatacggtatcggtagggattgggcaaggctactggattgcgacgccgattcag
atggtgaaagcgctggtggcgttgctgaataatggccgggtgattaatccgcatctgttg
ggcaaagtgcagcttggcaccactcagcagccttatgaagcaaaagatccgcagccgcaa
attggcgacccgaaatcaccttactggtcgctggtgcgtcatgcgatgtttggcatggcg
aatgcgccgaacggcaccggttacaaatatttccacaccgcgccttatggcattgcggca
aaaagcggaacttctcaggtatttagcctacggcagaaccaggtgtataacgcgaagatg
atcccgacgcgcctgcgtgaccatatcttctacactgccttcgcaccttttaacgatccc
aaagtggccgtggcgttgattttggagaatgggggaaatgaagggattaccgctgcgccg
gtgatgcgtaacatcctcgaccatatcttcctgccaccgccagccgtgccggtggagacc
gcgaatatcgctaacgcgccagcggcccgctaa

DBGET integrated database retrieval system